Gene Information

Name : cusR (MARHY3644)
Accession : YP_005431521.1
Strain : Marinobacter hydrocarbonoclasticus ATCC 49840
Genome accession: NC_017067
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator in two-component transcriptional regulatory system, regulation of copper resistance
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3769712 - 3770392 bp
Length : 681 bp
Strand : -
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 11004187, 11283292, 11399769, 8078459, 8449873; Product type r : regulator

DNA sequence : 
GTGAAAGCGCTGGTAATCGAAGACGATCGGGATGTAGCAAATTATCTGCTAAAGGGACTGAGGGAATCCGACTTCGTGGT
GGATCATGCGGCCGACGGCAAGGAAGGCATGATGATGGCGGCCAGTGAAGAATACGACATCATGATTGTCGACCGGATGT
TGCCGGGTATGGATGGCCTTTCCATTATCAAGACGGTACGGGCCACGGGCAACCAGACGCCGGTGCTGATTCTCAGTGCT
CTGGGCGATGTCGATGACCGTGTCGAAGGGCTGCGTGGCGGTGGCGATGACTACCTGACCAAGCCGTTTTCTTTCACCGA
GCTGTTGGCGCGCATCGAGTCACTGATTCGGCGTAACCGTCAGGCGGCCGAGACCGAGACCGTACTGAAAGTGGCGGATC
TGGAGATGGACCTGCTGGCCCGCACCGTAAAACGAGCCGGCCAGAATATTGATGTCCAGCCCCGGGAGTTCAGGCTGCTG
GAATACCTGATGCGTAATGCCGGGCAGGTGGTTACCCGTACCATGCTGCTGGAGAAAGTGTGGGATTATCACTTTGACCC
CCAGACCAACGTGATCGACGTGCATATCAGCCGTCTGCGCGCCAAGATCGACAAGGAATTCGATACACCCCTGCTGCAGA
CAGTGCGGGGGGCGGGATACATGTTACGTGAAACTGCTTAG

Protein sequence : 
MKALVIEDDRDVANYLLKGLRESDFVVDHAADGKEGMMMAASEEYDIMIVDRMLPGMDGLSIIKTVRATGNQTPVLILSA
LGDVDDRVEGLRGGGDDYLTKPFSFTELLARIESLIRRNRQAAETETVLKVADLEMDLLARTVKRAGQNIDVQPREFRLL
EYLMRNAGQVVTRTMLLEKVWDYHFDPQTNVIDVHISRLRAKIDKEFDTPLLQTVRGAGYMLRETA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-45 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-44 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_005431521.1 DNA-binding response regulator in two-component transcriptional regulatory system, regulation of copper resistance BAC0125 Protein 1e-52 52
cusR YP_005431521.1 DNA-binding response regulator in two-component transcriptional regulatory system, regulation of copper resistance BAC0347 Protein 2e-53 51
cusR YP_005431521.1 DNA-binding response regulator in two-component transcriptional regulatory system, regulation of copper resistance BAC0638 Protein 2e-47 50
cusR YP_005431521.1 DNA-binding response regulator in two-component transcriptional regulatory system, regulation of copper resistance BAC0083 Protein 6e-54 49
cusR YP_005431521.1 DNA-binding response regulator in two-component transcriptional regulatory system, regulation of copper resistance BAC0111 Protein 2e-55 48
cusR YP_005431521.1 DNA-binding response regulator in two-component transcriptional regulatory system, regulation of copper resistance BAC0197 Protein 3e-47 46
cusR YP_005431521.1 DNA-binding response regulator in two-component transcriptional regulatory system, regulation of copper resistance BAC0308 Protein 8e-49 45
cusR YP_005431521.1 DNA-binding response regulator in two-component transcriptional regulatory system, regulation of copper resistance HE999704.1.gene1528. Protein 7e-33 41
cusR YP_005431521.1 DNA-binding response regulator in two-component transcriptional regulatory system, regulation of copper resistance AE016830.1.gene1681. Protein 2e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_005431521.1 DNA-binding response regulator in two-component transcriptional regulatory system, regulation of copper resistance VFG0596 Protein 1e-45 44
cusR YP_005431521.1 DNA-binding response regulator in two-component transcriptional regulatory system, regulation of copper resistance VFG1389 Protein 2e-38 43
cusR YP_005431521.1 DNA-binding response regulator in two-component transcriptional regulatory system, regulation of copper resistance VFG1390 Protein 1e-43 41