Gene Information

Name : merR (MARHY1942)
Accession : YP_005429842.1
Strain : Marinobacter hydrocarbonoclasticus ATCC 49840
Genome accession: NC_017067
Putative virulence/resistance : Resistance
Product : Mercuric resistance operon regulatory protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1999822 - 2000256 bp
Length : 435 bp
Strand : +
Note : Evidence 2b : Function of strongly homologous gene; PubMedId : 2551364, 6091128; Product type r : regulator

DNA sequence :
ATGTCGGTTAAAGCCAGTTCACTGACTATTGGCGGCTTGGCCAAGGCGGCCAATGTAAATGTCGAGACGATCCGCTATTA
CCAGCGGCGAGGTCTGTTGTCGGAACCCAAACGACCTCTAGGTGGTATTCGACGCTACGGTTCCGCCGATATTGATCGGC
TGACATTTGTTAAAACGGCGCAGCAGCTGGGTTTCAGTCTCGACGAGGTCGGCGACCTTTTAAGGTTGGAAGATGGCACT
CACTGTCAGGAAGCCAGTGCGCTCGCCGAGCACAAGCTGAAGGATGTGCGTGAAAAGATCGAAAGGCTGGTCAAAATTGA
GAAGGCTCTGAGCGACATGGTCAGTCAATGCCACGCACAGCCGGACAGCATCGCGTGCCCGCTCATTGCATCTCTACATG
AGGGAGACATTGGAACAAAAAGCCAAAGGGATTAG

Protein sequence :
MSVKASSLTIGGLAKAANVNVETIRYYQRRGLLSEPKRPLGGIRRYGSADIDRLTFVKTAQQLGFSLDEVGDLLRLEDGT
HCQEASALAEHKLKDVREKIERLVKIEKALSDMVSQCHAQPDSIACPLIASLHEGDIGTKSQRD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 7e-44 65
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 5e-44 65
merR ACK44535.1 MerR Not tested SGI1 Protein 2e-42 64
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 2e-42 64
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 3e-42 64
merR AFG30124.1 MerR Not tested PAGI-2 Protein 2e-42 64
merR AGK07025.1 MerR Not tested SGI1 Protein 1e-41 63
merR AGK07083.1 MerR Not tested SGI1 Protein 1e-41 63
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 2e-39 61
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 5e-40 60
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 1e-27 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
merR YP_005429842.1 Mercuric resistance operon regulatory protein BAC0688 Protein 2e-43 67
merR YP_005429842.1 Mercuric resistance operon regulatory protein BAC0687 Protein 5e-43 64
merR YP_005429842.1 Mercuric resistance operon regulatory protein BAC0232 Protein 5e-43 64
merR YP_005429842.1 Mercuric resistance operon regulatory protein BAC0686 Protein 2e-42 64
merR YP_005429842.1 Mercuric resistance operon regulatory protein BAC0684 Protein 2e-43 63
merR YP_005429842.1 Mercuric resistance operon regulatory protein BAC0683 Protein 4e-43 63
merR YP_005429842.1 Mercuric resistance operon regulatory protein BAC0689 Protein 6e-41 63
merR YP_005429842.1 Mercuric resistance operon regulatory protein BAC0682 Protein 3e-22 41