Gene Information

Name : Q7S_24736 (Q7S_24736)
Accession : YP_005419201.1
Strain :
Genome accession: NC_017060
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 417344 - 418066 bp
Length : 723 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGGATAAGACGAAGAAGATCCTGATCGTTGAAGATGACGGGGATATCGCAGAACTGCTCAGCCTGCATCTGCGTGATGA
AGGTTATGAGATTACCCACGCCGCCGACGGCAATCTGGGGGTGGCACATCTGGAGAAGGGCGGCTGGGACGCGCTGATCC
TCGATCTGATGCTGCCGGGCGTTGATGGTCTGGAAATCTGCCGCCGTGCGCGCAATATGACGCGGTATACGCCGATCATT
ATTATCAGCGCGCGTTCCAGCGAAGTACATCGCGTGCTCGGGCTGGAACTGGGGGCGGACGATTATCTGGCGAAGCCGTT
CTCTATGCTGGAACTGGTGGCGCGGGTCAAGGCGCTGTTCCGGCGGCAGGAAGCGATGAGCCGTAATCTGAAAATGGATG
CCGGAACGCTGAGCTTTTCCGGGCTGGTGATCGACCCGATTGCGCGTGACGTGATGCTCAATCATCAGTCTGTCGAGCTG
ACGCCCCGCGAGTTTGACCTGTTGTATTTCTTTGCCAAAAATCCCGGCAAAGTATTCTCGCGACTCAGCCTGTTAAATCA
GGTCTGGGGCTATGAACACGAAGGGTATGAACATACGGTGAACACCCATATCAACCGGCTGCGCATCAAGATAGAAACCA
ATCCGGCCGAGCCGGAACGGATTCTGACCGTGTGGGGAAAAGGCTATAAATTCGTGTCCTCTTCTGAGGCGTCACAAGGG
TAA

Protein sequence :
MDKTKKILIVEDDGDIAELLSLHLRDEGYEITHAADGNLGVAHLEKGGWDALILDLMLPGVDGLEICRRARNMTRYTPII
IISARSSEVHRVLGLELGADDYLAKPFSMLELVARVKALFRRQEAMSRNLKMDAGTLSFSGLVIDPIARDVMLNHQSVEL
TPREFDLLYFFAKNPGKVFSRLSLLNQVWGYEHEGYEHTVNTHINRLRIKIETNPAEPERILTVWGKGYKFVSSSEASQG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-76 65
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-76 65

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Q7S_24736 YP_005419201.1 two component transcriptional regulator, winged helix family protein NC_012469.1.7685629. Protein 7e-41 44
Q7S_24736 YP_005419201.1 two component transcriptional regulator, winged helix family protein AE015929.1.gene1106. Protein 1e-31 43
Q7S_24736 YP_005419201.1 two component transcriptional regulator, winged helix family protein HE999704.1.gene1528. Protein 8e-36 43
Q7S_24736 YP_005419201.1 two component transcriptional regulator, winged helix family protein AE000516.2.gene3505. Protein 3e-37 43
Q7S_24736 YP_005419201.1 two component transcriptional regulator, winged helix family protein NC_002952.2859858.p0 Protein 1e-34 42
Q7S_24736 YP_005419201.1 two component transcriptional regulator, winged helix family protein NC_007622.3794948.p0 Protein 1e-34 42
Q7S_24736 YP_005419201.1 two component transcriptional regulator, winged helix family protein NC_003923.1003417.p0 Protein 1e-34 42
Q7S_24736 YP_005419201.1 two component transcriptional regulator, winged helix family protein NC_013450.8614146.p0 Protein 1e-34 42
Q7S_24736 YP_005419201.1 two component transcriptional regulator, winged helix family protein NC_002951.3238224.p0 Protein 1e-34 42
Q7S_24736 YP_005419201.1 two component transcriptional regulator, winged helix family protein NC_007793.3914065.p0 Protein 1e-34 42
Q7S_24736 YP_005419201.1 two component transcriptional regulator, winged helix family protein NC_002758.1121390.p0 Protein 1e-34 42
Q7S_24736 YP_005419201.1 two component transcriptional regulator, winged helix family protein NC_010079.5776364.p0 Protein 1e-34 42
Q7S_24736 YP_005419201.1 two component transcriptional regulator, winged helix family protein AF155139.2.orf0.gene Protein 7e-43 42
Q7S_24736 YP_005419201.1 two component transcriptional regulator, winged helix family protein NC_012469.1.7686381. Protein 4e-41 42
Q7S_24736 YP_005419201.1 two component transcriptional regulator, winged helix family protein AE016830.1.gene1681. Protein 1e-43 42
Q7S_24736 YP_005419201.1 two component transcriptional regulator, winged helix family protein HE999704.1.gene2815. Protein 6e-40 42
Q7S_24736 YP_005419201.1 two component transcriptional regulator, winged helix family protein NC_002952.2859905.p0 Protein 2e-41 41
Q7S_24736 YP_005419201.1 two component transcriptional regulator, winged helix family protein NC_007793.3914279.p0 Protein 3e-41 41
Q7S_24736 YP_005419201.1 two component transcriptional regulator, winged helix family protein NC_007622.3794472.p0 Protein 2e-41 41
Q7S_24736 YP_005419201.1 two component transcriptional regulator, winged helix family protein NC_002745.1124361.p0 Protein 3e-41 41
Q7S_24736 YP_005419201.1 two component transcriptional regulator, winged helix family protein NC_009782.5559369.p0 Protein 3e-41 41
Q7S_24736 YP_005419201.1 two component transcriptional regulator, winged helix family protein NC_002951.3237708.p0 Protein 3e-41 41
Q7S_24736 YP_005419201.1 two component transcriptional regulator, winged helix family protein NC_003923.1003749.p0 Protein 2e-41 41
Q7S_24736 YP_005419201.1 two component transcriptional regulator, winged helix family protein NC_002758.1121668.p0 Protein 3e-41 41
Q7S_24736 YP_005419201.1 two component transcriptional regulator, winged helix family protein NC_009641.5332272.p0 Protein 3e-41 41
Q7S_24736 YP_005419201.1 two component transcriptional regulator, winged helix family protein NC_013450.8614421.p0 Protein 3e-41 41
Q7S_24736 YP_005419201.1 two component transcriptional regulator, winged helix family protein FJ349556.1.orf0.gene Protein 3e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Q7S_24736 YP_005419201.1 two component transcriptional regulator, winged helix family protein VFG1563 Protein 3e-76 65
Q7S_24736 YP_005419201.1 two component transcriptional regulator, winged helix family protein VFG1702 Protein 2e-76 65