Gene Information

Name : RSPPHO_01752 (RSPPHO_01752)
Accession : YP_005417348.1
Strain : Rhodospirillum photometricum DSM 122
Genome accession: NC_017059
Putative virulence/resistance : Resistance
Product : Multidrug resistance protein, SMR family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2112086 - 2112415 bp
Length : 330 bp
Strand : +
Note : -

DNA sequence : 
ATGCACTGGGTTTATCTCGCCGTCGCCATCGGCGCCGAAATCATCGCCACGTCGGCCCTCAAAGCCTGCGACGGCTTTAC
CCGCCTCGCCCCCTCGGCCTTAGTCGTGGTGGGCTATCTGGTCTCCTTTTACGCCTTGTCCCACGCCTTAAAAACCCTTC
CCGTGGGCATCGCCTACGCCATCTGGTCCGGCCTCGGGATCGTCATCATCACCGCCGTCGGCTGGGTTCTCTACGGCCAG
AAACTGGAAGCACCGGCCCTGATCGGTATGGCCCTGATCGTCGCCGGCGTCGTCCTCATGAACGCCTTCCCCTCCTCGAC
CGACTCCTGA

Protein sequence : 
MHWVYLAVAIGAEIIATSALKACDGFTRLAPSALVVVGYLVSFYALSHALKTLPVGIAYAIWSGLGIVIITAVGWVLYGQ
KLEAPALIGMALIVAGVVLMNAFPSSTDS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 1e-25 58
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 1e-25 58
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-25 58
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 1e-25 58
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 1e-25 58
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 1e-25 58
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-25 58
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 1e-25 58
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 1e-25 58
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 1e-25 58
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-25 58
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 1e-25 58
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 1e-25 58
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-25 58
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 1e-25 58
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 1e-25 58
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 1e-25 58
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-25 58
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 1e-25 58
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 1e-25 58
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-25 58
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 1e-25 58
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 1e-25 58
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 1e-25 58
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 1e-25 58
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-25 58
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 1e-25 58
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 1e-25 58
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 1e-25 58
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-25 58
unnamed CAD42067.1 hypothetical protein Not tested PAI II 536 Protein 3e-18 47
unnamed CAD42068.1 hypothetical protein Not tested PAI II 536 Protein 2e-14 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RSPPHO_01752 YP_005417348.1 Multidrug resistance protein, SMR family BAC0324 Protein 1e-25 60
RSPPHO_01752 YP_005417348.1 Multidrug resistance protein, SMR family NC_010410.6003348.p0 Protein 5e-25 58
RSPPHO_01752 YP_005417348.1 Multidrug resistance protein, SMR family BAC0002 Protein 5e-25 58
RSPPHO_01752 YP_005417348.1 Multidrug resistance protein, SMR family BAC0322 Protein 1e-27 58
RSPPHO_01752 YP_005417348.1 Multidrug resistance protein, SMR family BAC0323 Protein 4e-26 58
RSPPHO_01752 YP_005417348.1 Multidrug resistance protein, SMR family CP004022.1.gene1549. Protein 2e-21 57
RSPPHO_01752 YP_005417348.1 Multidrug resistance protein, SMR family BAC0377 Protein 1e-20 53
RSPPHO_01752 YP_005417348.1 Multidrug resistance protein, SMR family BAC0150 Protein 2e-18 50
RSPPHO_01752 YP_005417348.1 Multidrug resistance protein, SMR family NC_002695.1.913273.p Protein 3e-18 50
RSPPHO_01752 YP_005417348.1 Multidrug resistance protein, SMR family CP001138.1.gene1489. Protein 9e-22 50
RSPPHO_01752 YP_005417348.1 Multidrug resistance protein, SMR family BAC0192 Protein 4e-16 47
RSPPHO_01752 YP_005417348.1 Multidrug resistance protein, SMR family BAC0477 Protein 1e-14 46
RSPPHO_01752 YP_005417348.1 Multidrug resistance protein, SMR family BAC0329 Protein 1e-16 44
RSPPHO_01752 YP_005417348.1 Multidrug resistance protein, SMR family BAC0139 Protein 7e-17 43
RSPPHO_01752 YP_005417348.1 Multidrug resistance protein, SMR family BAC0325 Protein 7e-14 42
RSPPHO_01752 YP_005417348.1 Multidrug resistance protein, SMR family BAC0249 Protein 8e-06 42
RSPPHO_01752 YP_005417348.1 Multidrug resistance protein, SMR family AE000516.2.gene3301. Protein 8e-06 42
RSPPHO_01752 YP_005417348.1 Multidrug resistance protein, SMR family BAC0216 Protein 8e-13 41
RSPPHO_01752 YP_005417348.1 Multidrug resistance protein, SMR family BAC0378 Protein 5e-11 41
RSPPHO_01752 YP_005417348.1 Multidrug resistance protein, SMR family BAC0327 Protein 1e-11 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RSPPHO_01752 YP_005417348.1 Multidrug resistance protein, SMR family VFG1586 Protein 1e-18 47
RSPPHO_01752 YP_005417348.1 Multidrug resistance protein, SMR family VFG1587 Protein 8e-15 42