Name : MGAS15252_0968 (MGAS15252_0968) Accession : YP_005389010.1 Strain : Streptococcus pyogenes MGAS15252 Genome accession: NC_017040 Putative virulence/resistance : Unknown Product : General stress response protein Function : - COG functional category : - COG ID : - EC number : - Position : 952799 - 952999 bp Length : 201 bp Strand : - Note : CDD hit: non-specific, cl1272 = CsbD-like; CsbD is a bacterial general stress response protein. It's expression is mediated by sigma-B, an alternative sigma factor. The role of CsbD in stress response is unclear. DNA sequence : GTGTCAGATGAAAAATATAATGCGAAATTAGATCAAGCTGGTGGCAAGTTAAAAGAAGGATTTGGTAAGATTTCTGGAGA TAAATCTTTAGAAACTGAAGGTAAAGTAGATAAAGTTACTGGAAAAGTTAAAGAGGTTATTGCAGACGCCAAAGATACTG TAAAAGGATTAGCTAAAGGCTTAGATAATAAAGATAAATAA Protein sequence : MSDEKYNAKLDQAGGKLKEGFGKISGDKSLETEGKVDKVTGKVKEVIADAKDTVKGLAKGLDNKDK |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
SAAV_0811 | YP_003281734.1 | hypothetical protein | Not tested | SaPIAv | Protein | 5e-05 | 42 |
CpC231_1473 | YP_005683837.1 | hypothetical protein | Not tested | PiCp 5 | Protein | 2e-04 | 42 |
cpfrc_01480 | YP_003783880.1 | hypothetical protein | Not tested | PiCp 5 | Protein | 2e-04 | 42 |
CpI19_1480 | YP_005685923.1 | hypothetical protein | Not tested | PiCp 5 | Protein | 2e-04 | 42 |
Cp1002_1471 | YP_005681738.1 | hypothetical protein | Not tested | PiCp 5 | Protein | 2e-04 | 42 |