Gene Information

Name : MGAS15252_0968 (MGAS15252_0968)
Accession : YP_005389010.1
Strain : Streptococcus pyogenes MGAS15252
Genome accession: NC_017040
Putative virulence/resistance : Unknown
Product : General stress response protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 952799 - 952999 bp
Length : 201 bp
Strand : -
Note : CDD hit: non-specific, cl1272 = CsbD-like; CsbD is a bacterial general stress response protein. It's expression is mediated by sigma-B, an alternative sigma factor. The role of CsbD in stress response is unclear.

DNA sequence :
GTGTCAGATGAAAAATATAATGCGAAATTAGATCAAGCTGGTGGCAAGTTAAAAGAAGGATTTGGTAAGATTTCTGGAGA
TAAATCTTTAGAAACTGAAGGTAAAGTAGATAAAGTTACTGGAAAAGTTAAAGAGGTTATTGCAGACGCCAAAGATACTG
TAAAAGGATTAGCTAAAGGCTTAGATAATAAAGATAAATAA

Protein sequence :
MSDEKYNAKLDQAGGKLKEGFGKISGDKSLETEGKVDKVTGKVKEVIADAKDTVKGLAKGLDNKDK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SAAV_0811 YP_003281734.1 hypothetical protein Not tested SaPIAv Protein 5e-05 42
CpC231_1473 YP_005683837.1 hypothetical protein Not tested PiCp 5 Protein 2e-04 42
cpfrc_01480 YP_003783880.1 hypothetical protein Not tested PiCp 5 Protein 2e-04 42
CpI19_1480 YP_005685923.1 hypothetical protein Not tested PiCp 5 Protein 2e-04 42
Cp1002_1471 YP_005681738.1 hypothetical protein Not tested PiCp 5 Protein 2e-04 42