Gene Information

Name : MRGA327_05660 (MRGA327_05660)
Accession : YP_005359605.1
Strain : Mycobacterium tuberculosis RGTB327
Genome accession: NC_017026
Putative virulence/resistance : Virulence
Product : two component response transcriptional regulatory protein PRRA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1006453 - 1007154 bp
Length : 702 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGGACACTGGTGTGACCTCACCTCGGGTGTTGGTCGTCGACGACGACTCCGATGTGCTCGCCTCGCTGGAACGCGGCTT
ACGGCTGTCCGGATTCGAGGTAGCGACCGCGGTGGACGGCGCCGAGGCCTTGCGCAGCGCCACCGAGAACCGGCCGGACG
CGATCGTGCTCGACATCAACATGCCAGTGCTCGATGGAGTCAGCGTCGTGACGGCACTACGCGCGATGGACAACGACGTC
CCGGTCTGTGTGCTATCCGCACGCAGCTCTGTCGATGACCGAGTGGCCGGATTGGAGGCCGGCGCCGACGATTACCTGGT
GAAACCGTTCGTGCTGGCCGAGCTGGTGGCACGGGTGAAGGCGCTGCTGCGCCGCCGCGGCTCCACTGCAACGTCGTCCT
CGGAAACCATCACGGTGGGCCCGCTGGAGGTGGACATCCCCGGCCGGCGGGCCCGGGTCAACGGCGTCGACGTCGACCTG
ACCAAGCGCGAATTCGACCTGCTCGCGGTGCTGGCCGAGCACAAGACCGCGGTGCTCTCCCGAGCGCAACTCCTGGAATT
GGTGTGGGGCTACGACTTCGCCGCCGACACCAACGTGGTGGACGTCTTCATCGGGTACCTGCGGCGCAAACTGGAGGCCG
GCGGTGGCCCTAGGCTGCTGCATACCGTCCGCGGAGTCGGATTCGTGCTGCGTATGCAGTGA

Protein sequence :
MDTGVTSPRVLVVDDDSDVLASLERGLRLSGFEVATAVDGAEALRSATENRPDAIVLDINMPVLDGVSVVTALRAMDNDV
PVCVLSARSSVDDRVAGLEAGADDYLVKPFVLAELVARVKALLRRRGSTATSSSETITVGPLEVDIPGRRARVNGVDVDL
TKREFDLLAVLAEHKTAVLSRAQLLELVWGYDFAADTNVVDVFIGYLRRKLEAGGGPRLLHTVRGVGFVLRMQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-25 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MRGA327_05660 YP_005359605.1 two component response transcriptional regulatory protein PRRA BAC0083 Protein 5e-31 46
MRGA327_05660 YP_005359605.1 two component response transcriptional regulatory protein PRRA BAC0125 Protein 7e-30 43
MRGA327_05660 YP_005359605.1 two component response transcriptional regulatory protein PRRA HE999704.1.gene1528. Protein 2e-31 43
MRGA327_05660 YP_005359605.1 two component response transcriptional regulatory protein PRRA BAC0197 Protein 6e-25 43
MRGA327_05660 YP_005359605.1 two component response transcriptional regulatory protein PRRA BAC0638 Protein 4e-24 43
MRGA327_05660 YP_005359605.1 two component response transcriptional regulatory protein PRRA NC_012469.1.7685629. Protein 4e-28 43
MRGA327_05660 YP_005359605.1 two component response transcriptional regulatory protein PRRA AE000516.2.gene3505. Protein 6e-29 43
MRGA327_05660 YP_005359605.1 two component response transcriptional regulatory protein PRRA BAC0308 Protein 1e-27 42
MRGA327_05660 YP_005359605.1 two component response transcriptional regulatory protein PRRA NC_002952.2859905.p0 Protein 2e-27 42
MRGA327_05660 YP_005359605.1 two component response transcriptional regulatory protein PRRA NC_007793.3914279.p0 Protein 3e-27 42
MRGA327_05660 YP_005359605.1 two component response transcriptional regulatory protein PRRA NC_003923.1003749.p0 Protein 3e-27 42
MRGA327_05660 YP_005359605.1 two component response transcriptional regulatory protein PRRA NC_002745.1124361.p0 Protein 3e-27 42
MRGA327_05660 YP_005359605.1 two component response transcriptional regulatory protein PRRA NC_009782.5559369.p0 Protein 3e-27 42
MRGA327_05660 YP_005359605.1 two component response transcriptional regulatory protein PRRA NC_002951.3237708.p0 Protein 3e-27 42
MRGA327_05660 YP_005359605.1 two component response transcriptional regulatory protein PRRA NC_002758.1121668.p0 Protein 3e-27 42
MRGA327_05660 YP_005359605.1 two component response transcriptional regulatory protein PRRA NC_007622.3794472.p0 Protein 2e-27 42
MRGA327_05660 YP_005359605.1 two component response transcriptional regulatory protein PRRA NC_009641.5332272.p0 Protein 3e-27 42
MRGA327_05660 YP_005359605.1 two component response transcriptional regulatory protein PRRA NC_013450.8614421.p0 Protein 3e-27 42
MRGA327_05660 YP_005359605.1 two component response transcriptional regulatory protein PRRA HE999704.1.gene2815. Protein 3e-27 42
MRGA327_05660 YP_005359605.1 two component response transcriptional regulatory protein PRRA BAC0347 Protein 7e-24 41
MRGA327_05660 YP_005359605.1 two component response transcriptional regulatory protein PRRA BAC0111 Protein 5e-26 41
MRGA327_05660 YP_005359605.1 two component response transcriptional regulatory protein PRRA NC_012469.1.7686381. Protein 2e-23 41
MRGA327_05660 YP_005359605.1 two component response transcriptional regulatory protein PRRA NC_002516.2.879194.p Protein 1e-21 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MRGA327_05660 YP_005359605.1 two component response transcriptional regulatory protein PRRA VFG1389 Protein 5e-86 100
MRGA327_05660 YP_005359605.1 two component response transcriptional regulatory protein PRRA VFG1390 Protein 2e-41 50
MRGA327_05660 YP_005359605.1 two component response transcriptional regulatory protein PRRA VFG1386 Protein 1e-36 46
MRGA327_05660 YP_005359605.1 two component response transcriptional regulatory protein PRRA VFG0596 Protein 6e-26 42