Gene Information

Name : OCU_09000 (OCU_09000)
Accession : YP_005336441.1
Strain : Mycobacterium intracellulare ATCC 13950
Genome accession: NC_016946
Putative virulence/resistance : Virulence
Product : two component response transcriptional regulatory protein prra
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 879412 - 880083 bp
Length : 672 bp
Strand : -
Note : -

DNA sequence :
TTGGTCGTCGACGACGACTCCGATGTGCTCGCGTCGCTGGAACGTGGCCTGCGCCTGTCCGGGTTCGAGGTGTCGACCGC
GGTCGACGGCGCCGAGGCGTTGCGCAGCGCCACCGAAACGCGGCCGGACGCGATCGTGCTCGACATCAACATGCCGGTGC
TGGACGGGGTCAGCGTCGTCACCGCGCTGCGCGCCATGGACAACGACGTCCCGGTCTGCGTGCTCTCCGCCCGCAGCTCG
GTCGACGACCGGGTGGCGGGCCTGGAGGCCGGCGCCGACGATTACCTGGTCAAACCGTTCGTGCTGGCCGAGCTGGTCGC
GCGGGTCAAAGCGCTGCTGCGCCGCCGCGGCGCCACCGCAACCTCCTCGTCGGAGACCATCACGGTGGGACCGCTGGAAG
TCGACATCCCCGGCCGGCGGGCCCGCGTCAACGGCGTCGACGTCGACCTGACCAAGCGGGAATTCGACCTGCTGGCGGTG
CTGGCCGAACACAAGACCGCGGTCCTGTCCCGCGCGCAGCTACTCGAGCTGGTGTGGGGCTATGACTTCGCCGCCGACAC
CAACGTCGTCGACGTCTTCATCGGATACCTGCGCCGCAAGCTCGAGGCCCACGGCGGGCCCCGGCTGCTGCACACCGTGC
GCGGAGTGGGATTCGTGCTGCGCATGCAGTAA

Protein sequence :
MVVDDDSDVLASLERGLRLSGFEVSTAVDGAEALRSATETRPDAIVLDINMPVLDGVSVVTALRAMDNDVPVCVLSARSS
VDDRVAGLEAGADDYLVKPFVLAELVARVKALLRRRGATATSSSETITVGPLEVDIPGRRARVNGVDVDLTKREFDLLAV
LAEHKTAVLSRAQLLELVWGYDFAADTNVVDVFIGYLRRKLEAHGGPRLLHTVRGVGFVLRMQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-25 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
OCU_09000 YP_005336441.1 two component response transcriptional regulatory protein prra BAC0083 Protein 7e-31 46
OCU_09000 YP_005336441.1 two component response transcriptional regulatory protein prra BAC0125 Protein 1e-30 44
OCU_09000 YP_005336441.1 two component response transcriptional regulatory protein prra BAC0197 Protein 1e-24 44
OCU_09000 YP_005336441.1 two component response transcriptional regulatory protein prra AE000516.2.gene3505. Protein 7e-29 44
OCU_09000 YP_005336441.1 two component response transcriptional regulatory protein prra BAC0638 Protein 4e-24 43
OCU_09000 YP_005336441.1 two component response transcriptional regulatory protein prra NC_012469.1.7685629. Protein 1e-26 43
OCU_09000 YP_005336441.1 two component response transcriptional regulatory protein prra NC_009782.5559369.p0 Protein 8e-27 42
OCU_09000 YP_005336441.1 two component response transcriptional regulatory protein prra NC_002951.3237708.p0 Protein 8e-27 42
OCU_09000 YP_005336441.1 two component response transcriptional regulatory protein prra NC_003923.1003749.p0 Protein 8e-27 42
OCU_09000 YP_005336441.1 two component response transcriptional regulatory protein prra NC_002758.1121668.p0 Protein 8e-27 42
OCU_09000 YP_005336441.1 two component response transcriptional regulatory protein prra NC_007622.3794472.p0 Protein 5e-27 42
OCU_09000 YP_005336441.1 two component response transcriptional regulatory protein prra NC_009641.5332272.p0 Protein 8e-27 42
OCU_09000 YP_005336441.1 two component response transcriptional regulatory protein prra NC_013450.8614421.p0 Protein 8e-27 42
OCU_09000 YP_005336441.1 two component response transcriptional regulatory protein prra NC_007793.3914279.p0 Protein 8e-27 42
OCU_09000 YP_005336441.1 two component response transcriptional regulatory protein prra NC_002745.1124361.p0 Protein 8e-27 42
OCU_09000 YP_005336441.1 two component response transcriptional regulatory protein prra HE999704.1.gene1528. Protein 1e-30 42
OCU_09000 YP_005336441.1 two component response transcriptional regulatory protein prra NC_002952.2859905.p0 Protein 6e-27 42
OCU_09000 YP_005336441.1 two component response transcriptional regulatory protein prra HE999704.1.gene2815. Protein 3e-26 42
OCU_09000 YP_005336441.1 two component response transcriptional regulatory protein prra NC_002952.2859858.p0 Protein 9e-33 41
OCU_09000 YP_005336441.1 two component response transcriptional regulatory protein prra NC_007622.3794948.p0 Protein 9e-33 41
OCU_09000 YP_005336441.1 two component response transcriptional regulatory protein prra NC_003923.1003417.p0 Protein 9e-33 41
OCU_09000 YP_005336441.1 two component response transcriptional regulatory protein prra NC_013450.8614146.p0 Protein 9e-33 41
OCU_09000 YP_005336441.1 two component response transcriptional regulatory protein prra NC_002951.3238224.p0 Protein 9e-33 41
OCU_09000 YP_005336441.1 two component response transcriptional regulatory protein prra NC_007793.3914065.p0 Protein 9e-33 41
OCU_09000 YP_005336441.1 two component response transcriptional regulatory protein prra NC_002758.1121390.p0 Protein 9e-33 41
OCU_09000 YP_005336441.1 two component response transcriptional regulatory protein prra NC_010079.5776364.p0 Protein 9e-33 41
OCU_09000 YP_005336441.1 two component response transcriptional regulatory protein prra BAC0347 Protein 5e-24 41
OCU_09000 YP_005336441.1 two component response transcriptional regulatory protein prra BAC0308 Protein 6e-28 41
OCU_09000 YP_005336441.1 two component response transcriptional regulatory protein prra BAC0111 Protein 6e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
OCU_09000 YP_005336441.1 two component response transcriptional regulatory protein prra VFG1389 Protein 1e-82 99
OCU_09000 YP_005336441.1 two component response transcriptional regulatory protein prra VFG1390 Protein 1e-41 50
OCU_09000 YP_005336441.1 two component response transcriptional regulatory protein prra VFG1386 Protein 4e-36 46
OCU_09000 YP_005336441.1 two component response transcriptional regulatory protein prra VFG0596 Protein 1e-25 42