Gene Information

Name : O3Y_17233 (O3Y_17233)
Accession : YP_005335251.1
Strain :
Genome accession: NC_016945
Putative virulence/resistance : Unknown
Product : transposase OrfAB subunit A
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 736462 - 736806 bp
Length : 345 bp
Strand : -
Note : COG2963 Transposase and inactivated derivatives

DNA sequence :
GTGATATCATCACCTCATAAGTTAACAGGTGACATTATGACAAAACGTACAAGACGACTATTTAGCGCAGAATTTAAGTT
AGAAGCAGCGCAGCTAGTCTTAGACCAAAATTACTCAGTGACGGAAGCAGCCCAAGCCATGAATGTGGGCAAGTCCACGA
TGGATAAATGGGTTCGCCAGCTTAGAGAAGAACGCCAAGGGAAAACACCTAAAGCTTCACCTATGACCCCTGAGCAAATA
GAAATTCGGGAATTGAAAAAGAAGCTGGCTCGCCTTGAAGAGCATAATGAAATACTAAAAAAAGCCACGGCTCTCTTGAT
GTCGGACTCACTGAACAATTCTTGA

Protein sequence :
MISSPHKLTGDIMTKRTRRLFSAEFKLEAAQLVLDQNYSVTEAAQAMNVGKSTMDKWVRQLREERQGKTPKASPMTPEQI
EIRELKKKLARLEEHNEILKKATALLMSDSLNNS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-48 100
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-48 100
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-48 100
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-48 100
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-48 100
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-48 100
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-48 100
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-48 100
l7045 CAD33744.1 - Not tested PAI I 536 Protein 2e-31 77
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 2e-31 77
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 6e-31 77
api80 CAF28554.1 putative transposase Not tested YAPI Protein 5e-27 75
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 5e-26 69
unnamed AAC31483.1 L0004 Not tested LEE Protein 3e-31 64
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 2e-31 64
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 4e-31 64
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 4e-31 64
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 2e-31 64
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 1e-27 64
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 6e-22 56
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 2e-18 49
tnpA CAB61575.1 transposase A Not tested HPI Protein 6e-18 48
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 1e-13 45
unnamed CAD33780.1 putative transposase Not tested PAI I 536 Protein 4e-12 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
O3Y_17233 YP_005335251.1 transposase OrfAB subunit A VFG1123 Protein 5e-49 100
O3Y_17233 YP_005335251.1 transposase OrfAB subunit A VFG1485 Protein 9e-32 77
O3Y_17233 YP_005335251.1 transposase OrfAB subunit A VFG1553 Protein 2e-26 69
O3Y_17233 YP_005335251.1 transposase OrfAB subunit A VFG0784 Protein 1e-31 64
O3Y_17233 YP_005335251.1 transposase OrfAB subunit A VFG1566 Protein 4e-14 45
O3Y_17233 YP_005335251.1 transposase OrfAB subunit A VFG1521 Protein 2e-12 42