Gene Information

Name : BLASA_4966 (BLASA_4966)
Accession : YP_005331766.1
Strain : Blastococcus saxobsidens DD2
Genome accession: NC_016943
Putative virulence/resistance : Virulence
Product : Two-component transcriptional regulator, CheY-like receiver domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4761373 - 4762047 bp
Length : 675 bp
Strand : +
Note : Evidence 2b : Function of strongly homologous gene; Product type r : regulator

DNA sequence :
ATGCGGGTGCTGGTCGTCGAGGACCACGGCAACATGCGCGACGTCCTCGTGCGCGGCCTGACCGAAGCCGGGCACGCCGT
GGACGCCGTCGCCGACGGGCCCGGTGGGCTCGCCCGGGCCGCGACCGGCAGCTACGACGCCGTGGTGCTCGACGTGATGC
TCCCCGGCATGGACGGCTTCGCCGTCTGCGCGGCGCTGCGCGACCGGCAGGTGTGGACGCCGGTGCTCATGCTCACCGCC
CGGGACGCCGTGCCGGACCGGGTGCACGGGCTGGACGCCGGCGCCGACGACTACCTGGTCAAGCCGTTCGCCTTCACCGA
GCTGCTCGGCCGGCTGCGGGCCCTGCAGCGCCGCGGCGCACCGCCACGGCCGGCGGTGCTCGGCTGCGGCCCGCTCTCCT
TGGACCCGGCGGCCCGCGTGGTGCGCTGCGGCGGCCAGGTCGTGGAGCTCTCCCGCCGCGAGTTCACGCTGCTGGAGTTC
CTGCTGCGCCACCCCGGGCACGTGCTCTCCCGGGCACAGATCCTCGAGCACGTCTGGGGCCACGACTACGACGGCCAGTC
CAACGTCGTCGACGTCTACGTGAAGTACCTCCGCGACAAGATCGACCGGCGGTTCGGCCTGGATCTGGTGCAGACCGTGC
GCGGCACGGGCTACCGGGTGGCGTGCGCGGAGTGA

Protein sequence :
MRVLVVEDHGNMRDVLVRGLTEAGHAVDAVADGPGGLARAATGSYDAVVLDVMLPGMDGFAVCAALRDRQVWTPVLMLTA
RDAVPDRVHGLDAGADDYLVKPFAFTELLGRLRALQRRGAPPRPAVLGCGPLSLDPAARVVRCGGQVVELSRREFTLLEF
LLRHPGHVLSRAQILEHVWGHDYDGQSNVVDVYVKYLRDKIDRRFGLDLVQTVRGTGYRVACAE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-29 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-29 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BLASA_4966 YP_005331766.1 Two-component transcriptional regulator, CheY-like receiver domain BAC0125 Protein 4e-34 49
BLASA_4966 YP_005331766.1 Two-component transcriptional regulator, CheY-like receiver domain BAC0197 Protein 4e-33 49
BLASA_4966 YP_005331766.1 Two-component transcriptional regulator, CheY-like receiver domain BAC0083 Protein 2e-29 46
BLASA_4966 YP_005331766.1 Two-component transcriptional regulator, CheY-like receiver domain BAC0638 Protein 9e-30 45
BLASA_4966 YP_005331766.1 Two-component transcriptional regulator, CheY-like receiver domain BAC0308 Protein 4e-31 45
BLASA_4966 YP_005331766.1 Two-component transcriptional regulator, CheY-like receiver domain BAC0347 Protein 3e-28 44
BLASA_4966 YP_005331766.1 Two-component transcriptional regulator, CheY-like receiver domain BAC0111 Protein 5e-31 44
BLASA_4966 YP_005331766.1 Two-component transcriptional regulator, CheY-like receiver domain AE015929.1.gene1106. Protein 2e-25 42
BLASA_4966 YP_005331766.1 Two-component transcriptional regulator, CheY-like receiver domain HE999704.1.gene1528. Protein 4e-29 42
BLASA_4966 YP_005331766.1 Two-component transcriptional regulator, CheY-like receiver domain NC_003923.1003417.p0 Protein 2e-29 41
BLASA_4966 YP_005331766.1 Two-component transcriptional regulator, CheY-like receiver domain NC_013450.8614146.p0 Protein 2e-29 41
BLASA_4966 YP_005331766.1 Two-component transcriptional regulator, CheY-like receiver domain NC_002951.3238224.p0 Protein 2e-29 41
BLASA_4966 YP_005331766.1 Two-component transcriptional regulator, CheY-like receiver domain NC_007793.3914065.p0 Protein 2e-29 41
BLASA_4966 YP_005331766.1 Two-component transcriptional regulator, CheY-like receiver domain NC_002758.1121390.p0 Protein 2e-29 41
BLASA_4966 YP_005331766.1 Two-component transcriptional regulator, CheY-like receiver domain NC_010079.5776364.p0 Protein 2e-29 41
BLASA_4966 YP_005331766.1 Two-component transcriptional regulator, CheY-like receiver domain NC_002952.2859858.p0 Protein 2e-29 41
BLASA_4966 YP_005331766.1 Two-component transcriptional regulator, CheY-like receiver domain NC_007622.3794948.p0 Protein 2e-29 41
BLASA_4966 YP_005331766.1 Two-component transcriptional regulator, CheY-like receiver domain NC_002516.2.879194.p Protein 6e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BLASA_4966 YP_005331766.1 Two-component transcriptional regulator, CheY-like receiver domain VFG1390 Protein 4e-33 46
BLASA_4966 YP_005331766.1 Two-component transcriptional regulator, CheY-like receiver domain VFG1389 Protein 5e-28 46
BLASA_4966 YP_005331766.1 Two-component transcriptional regulator, CheY-like receiver domain VFG0596 Protein 4e-30 45
BLASA_4966 YP_005331766.1 Two-component transcriptional regulator, CheY-like receiver domain VFG1386 Protein 1e-28 43