Gene Information

Name : mtrA (BLASA_4104)
Accession : YP_005330958.1
Strain : Blastococcus saxobsidens DD2
Genome accession: NC_016943
Putative virulence/resistance : Virulence
Product : Two component DNA-binding response regulator mtrA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3966656 - 3967363 bp
Length : 708 bp
Strand : -
Note : Evidence 2b : Function of strongly homologous gene; Product type r : regulator

DNA sequence :
GTGCCACCCACCGCGCCTCAGAACGGACCCTCCCGCGGCCGTGTCCTGGTCGTCGACGACGACGCCGCCCTCGCCGAGAT
GCTCGGCATCGTGCTGCGGCGCGAGGGATACGAACCGGCCTTCGTCTCCGACGGCAACCGGGCCGTCGGCGTCTTCCAGC
AGACCCGGCCCGACCTGGTCCTGCTGGACCTGATGCTGCCCGGCCGCAACGGTCTGCAGATCTGCCAGGACATCCGCACG
CAGTCGACGGTGCCGATCGTCATGCTGACCGCCAAGGGCGACACGATCGACGTCGTCCAGGGGCTGGAGGCCGGCGCCGA
CGACTACGTCACCAAGCCGTTCAAGCCGGTGGAGCTGGTGGCGCGCGTGCGCGCCCAGCTGCGCCGTGGCGAGACCGGGC
AGGCGGAGAACCTGAGCATCGGTGACGTGCAGATCGACGTCCCGGCGCACCAGGTGAGCCGCGACGGCGTGCCGATCGCG
CTCACCCCGCTGGAGTTCGACCTGCTCGTCGCCCTGGCCCGCAAGCCGCGGCAGGTGTTCACCCGGGAACTGCTGCTCGA
GCAGGTCTGGGGCTACCGGCACGCGGCGGACACCCGCCTGGTCAACGTGCACGTGCAGCGGCTGCGGGCGAAGGTCGAGC
GGGATCCGGAGCGGCCCGAGATCGTGCTCACCGTGCGCGGGGTGGGGTACAAGGCCGGGCCGCCGTGA

Protein sequence :
MPPTAPQNGPSRGRVLVVDDDAALAEMLGIVLRREGYEPAFVSDGNRAVGVFQQTRPDLVLLDLMLPGRNGLQICQDIRT
QSTVPIVMLTAKGDTIDVVQGLEAGADDYVTKPFKPVELVARVRAQLRRGETGQAENLSIGDVQIDVPAHQVSRDGVPIA
LTPLEFDLLVALARKPRQVFTRELLLEQVWGYRHAADTRLVNVHVQRLRAKVERDPERPEIVLTVRGVGYKAGPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-37 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-37 42
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 2e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA AE000516.2.gene3505. Protein 2e-75 71
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA NC_012469.1.7685629. Protein 3e-44 46
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA NC_002952.2859905.p0 Protein 3e-45 44
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA NC_003923.1003749.p0 Protein 5e-45 44
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA NC_007622.3794472.p0 Protein 3e-45 44
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA NC_002745.1124361.p0 Protein 5e-45 44
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA NC_009782.5559369.p0 Protein 5e-45 44
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA NC_002951.3237708.p0 Protein 5e-45 44
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA NC_002758.1121668.p0 Protein 5e-45 44
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA NC_009641.5332272.p0 Protein 5e-45 44
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA AF155139.2.orf0.gene Protein 4e-39 44
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA NC_013450.8614421.p0 Protein 5e-45 44
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA NC_007793.3914279.p0 Protein 5e-45 44
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA NC_002695.1.916589.p Protein 2e-38 43
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA BAC0039 Protein 4e-38 43
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA CP000034.1.gene2186. Protein 4e-38 43
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA HE999704.1.gene2815. Protein 2e-41 42
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA BAC0596 Protein 2e-38 42
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA CP001918.1.gene3444. Protein 1e-37 42
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA CP001138.1.gene2239. Protein 2e-38 42
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA CP000647.1.gene2531. Protein 3e-37 42
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA NC_002951.3238224.p0 Protein 3e-39 41
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA NC_007793.3914065.p0 Protein 3e-39 41
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA NC_002758.1121390.p0 Protein 3e-39 41
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA NC_010079.5776364.p0 Protein 3e-39 41
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA NC_002952.2859858.p0 Protein 3e-39 41
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA NC_007622.3794948.p0 Protein 3e-39 41
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA NC_003923.1003417.p0 Protein 3e-39 41
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA NC_013450.8614146.p0 Protein 3e-39 41
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA AE015929.1.gene1106. Protein 2e-34 41
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA AE016830.1.gene1681. Protein 4e-42 41
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA BAC0125 Protein 8e-35 41
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA NC_012469.1.7686381. Protein 8e-43 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA VFG1389 Protein 2e-31 43
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA VFG1390 Protein 8e-36 42
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA VFG1563 Protein 6e-38 42
mtrA YP_005330958.1 Two component DNA-binding response regulator mtrA VFG1702 Protein 1e-37 42