Gene Information

Name : copR (BLASA_3331)
Accession : YP_005330229.1
Strain : Blastococcus saxobsidens DD2
Genome accession: NC_016943
Putative virulence/resistance : Virulence
Product : Two component response regulator protein copR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3202608 - 3203285 bp
Length : 678 bp
Strand : +
Note : Evidence 2b : Function of strongly homologous gene; Product type r : regulator

DNA sequence :
GTGCGGGTGCTGGTGGTCGAGGACGAGCGGAACCTGGCGGCCGCCGTGGCCCGTGGCTTGCACGCCGAGGGCTTCTCGGT
GGACGTCGCCGGCGACGGCGTGACCGGTCTGGACCGGGCGCTGCTGGGCGGCTACGGCGCCATCGTCCTGGACATCATGC
TGCCGGGCCGCTCCGGGTACGACGTGCTGCGCGAGCTCCGGGCCCGCCAGGTGTGGACGCCGGTGCTGATGCTGACGGCG
AAGGACGGTGAGTACGACATCGCCGATGCCCTCGACCTGGGCGCCGACGACTACCTGACCAAGCCGTTCCCGTTCGTCGT
CCTGGTGGCCCGGCTGCGTGCACTCGTGCGGCGGGGAGTCCCCGAGCGACCGGCGCAGCTGGTCGTGGGCGACCTCGTCC
TGGACCCGGCCGCGCACCGGGTGCGGCGCGGGGACACCGAGCTGTCGTTGACCGCCCGGGAGTTCGCGCTGCTCGAGCAC
CTGATGCGGCGCGCGGGTGACGCAGTGGCGAAGTCCGAGCTGCTGGCCGAGGTGTGGGACGAGAACTTCGCCGGCGACCC
GAACATCGTCGAGGTCTACGTCGGCTACCTCCGGCGCAAGATCGACGCCCCCTTCGGCTGCACGAGCATCGAGACCGTGC
GCGGCGTCGGCTACCGCATCGAGGCCACCGGCGGATGA

Protein sequence :
MRVLVVEDERNLAAAVARGLHAEGFSVDVAGDGVTGLDRALLGGYGAIVLDIMLPGRSGYDVLRELRARQVWTPVLMLTA
KDGEYDIADALDLGADDYLTKPFPFVVLVARLRALVRRGVPERPAQLVVGDLVLDPAAHRVRRGDTELSLTAREFALLEH
LMRRAGDAVAKSELLAEVWDENFAGDPNIVEVYVGYLRRKIDAPFGCTSIETVRGVGYRIEATGG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-28 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-27 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copR YP_005330229.1 Two component response regulator protein copR BAC0083 Protein 2e-29 45
copR YP_005330229.1 Two component response regulator protein copR BAC0197 Protein 2e-29 45
copR YP_005330229.1 Two component response regulator protein copR Y16952.3.orf35.gene. Protein 2e-20 44
copR YP_005330229.1 Two component response regulator protein copR BAC0125 Protein 1e-31 44
copR YP_005330229.1 Two component response regulator protein copR BAC0111 Protein 4e-31 44
copR YP_005330229.1 Two component response regulator protein copR BAC0638 Protein 8e-22 44
copR YP_005330229.1 Two component response regulator protein copR U82965.2.orf14.gene. Protein 3e-18 44
copR YP_005330229.1 Two component response regulator protein copR BAC0347 Protein 5e-25 42
copR YP_005330229.1 Two component response regulator protein copR BAC0308 Protein 4e-24 42
copR YP_005330229.1 Two component response regulator protein copR AE000516.2.gene3505. Protein 8e-22 42
copR YP_005330229.1 Two component response regulator protein copR NC_007622.3794948.p0 Protein 3e-22 41
copR YP_005330229.1 Two component response regulator protein copR NC_003923.1003417.p0 Protein 3e-22 41
copR YP_005330229.1 Two component response regulator protein copR NC_013450.8614146.p0 Protein 3e-22 41
copR YP_005330229.1 Two component response regulator protein copR NC_002951.3238224.p0 Protein 3e-22 41
copR YP_005330229.1 Two component response regulator protein copR NC_007793.3914065.p0 Protein 3e-22 41
copR YP_005330229.1 Two component response regulator protein copR NC_002758.1121390.p0 Protein 3e-22 41
copR YP_005330229.1 Two component response regulator protein copR NC_010079.5776364.p0 Protein 3e-22 41
copR YP_005330229.1 Two component response regulator protein copR NC_002952.2859858.p0 Protein 3e-22 41
copR YP_005330229.1 Two component response regulator protein copR AE015929.1.gene1106. Protein 4e-21 41
copR YP_005330229.1 Two component response regulator protein copR HE999704.1.gene1528. Protein 4e-24 41
copR YP_005330229.1 Two component response regulator protein copR NC_002516.2.879194.p Protein 2e-16 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copR YP_005330229.1 Two component response regulator protein copR VFG1390 Protein 1e-27 46
copR YP_005330229.1 Two component response regulator protein copR VFG0596 Protein 8e-29 44
copR YP_005330229.1 Two component response regulator protein copR VFG1386 Protein 2e-26 42