Gene Information

Name : afsQ (BLASA_2953)
Accession : YP_005329855.1
Strain : Blastococcus saxobsidens DD2
Genome accession: NC_016943
Putative virulence/resistance : Virulence
Product : Two component transcriptional regulatory protein afsQ1
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2821493 - 2822170 bp
Length : 678 bp
Strand : +
Note : Evidence 2b : Function of strongly homologous gene; Product type r : regulator

DNA sequence :
ATGTCGCGGTCTGTGCTGATCATCGAGGACGACCCGCGGATCCGGCGCATGCTCCAGATGACCCTGCAGCGCGAGGGGCT
GGAGGTCACCGAGGCCGAGAGCGGAGAAGCTGCCCTGGAGAAGCTGGCCGAGCACCCCTTCGACGTGATCCTGCTGGACC
TGATGCTGCCGGGCATGGACGGTTTCGAGGTGTGCCGGGAGATCCGCAAGACGTCCAACACCCCGGTGATCATGGTGACC
GCCCGCTCGGACAGCCACGACGTCGTCGCCGGGCTGGAGGCCGGCGCCGACGACTACGTCTCCAAGCCGTTCGTCGTCAA
GGAGCTCTCCGCGCGCATCCGTGCGCTGGCGCGGCGGACCCGCGCCCCCGAACCCCGGGTCCGGCTCACCGTGGGAGACC
TGGAGGTCTCACCGAGCGAGGGCACCGTCACCCGGGGCGGCGAGCTGCTCAACCTGACCCGCACGGAGTTCCGGCTGCTC
ACCGAGCTCGCCGCGGAGCCCGGGCGCGTGCTCAGCCGCGAGGAGCTGCTGGAACGGGTGTGGGGATACGACTACTTCGG
TGACTCCCGGCTGGTCGACGTCCACGTGCGCCGGCTGCGCAAGAAGATCGAGCCGGACCCCGCGACCCCGACGCTCGTGA
CCACCGTCCGGGGCATGGGCTACCGGGTCCCGGGGTGA

Protein sequence :
MSRSVLIIEDDPRIRRMLQMTLQREGLEVTEAESGEAALEKLAEHPFDVILLDLMLPGMDGFEVCREIRKTSNTPVIMVT
ARSDSHDVVAGLEAGADDYVSKPFVVKELSARIRALARRTRAPEPRVRLTVGDLEVSPSEGTVTRGGELLNLTRTEFRLL
TELAAEPGRVLSREELLERVWGYDYFGDSRLVDVHVRRLRKKIEPDPATPTLVTTVRGMGYRVPG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 8e-28 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-27 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
afsQ YP_005329855.1 Two component transcriptional regulatory protein afsQ1 BAC0125 Protein 2e-28 46
afsQ YP_005329855.1 Two component transcriptional regulatory protein afsQ1 AE000516.2.gene3505. Protein 1e-39 46
afsQ YP_005329855.1 Two component transcriptional regulatory protein afsQ1 NC_012469.1.7685629. Protein 2e-36 45
afsQ YP_005329855.1 Two component transcriptional regulatory protein afsQ1 HE999704.1.gene1528. Protein 2e-30 44
afsQ YP_005329855.1 Two component transcriptional regulatory protein afsQ1 NC_002952.2859905.p0 Protein 1e-33 43
afsQ YP_005329855.1 Two component transcriptional regulatory protein afsQ1 NC_007793.3914279.p0 Protein 2e-33 43
afsQ YP_005329855.1 Two component transcriptional regulatory protein afsQ1 NC_002745.1124361.p0 Protein 2e-33 43
afsQ YP_005329855.1 Two component transcriptional regulatory protein afsQ1 NC_009782.5559369.p0 Protein 2e-33 43
afsQ YP_005329855.1 Two component transcriptional regulatory protein afsQ1 NC_002951.3237708.p0 Protein 2e-33 43
afsQ YP_005329855.1 Two component transcriptional regulatory protein afsQ1 NC_003923.1003749.p0 Protein 2e-33 43
afsQ YP_005329855.1 Two component transcriptional regulatory protein afsQ1 NC_002758.1121668.p0 Protein 2e-33 43
afsQ YP_005329855.1 Two component transcriptional regulatory protein afsQ1 NC_007622.3794472.p0 Protein 1e-33 43
afsQ YP_005329855.1 Two component transcriptional regulatory protein afsQ1 NC_009641.5332272.p0 Protein 2e-33 43
afsQ YP_005329855.1 Two component transcriptional regulatory protein afsQ1 NC_013450.8614421.p0 Protein 2e-33 43
afsQ YP_005329855.1 Two component transcriptional regulatory protein afsQ1 BAC0197 Protein 3e-25 43
afsQ YP_005329855.1 Two component transcriptional regulatory protein afsQ1 CP000675.2.gene1535. Protein 2e-27 42
afsQ YP_005329855.1 Two component transcriptional regulatory protein afsQ1 HE999704.1.gene2815. Protein 3e-32 42
afsQ YP_005329855.1 Two component transcriptional regulatory protein afsQ1 NC_012469.1.7686381. Protein 8e-34 41
afsQ YP_005329855.1 Two component transcriptional regulatory protein afsQ1 NC_002951.3238224.p0 Protein 3e-32 41
afsQ YP_005329855.1 Two component transcriptional regulatory protein afsQ1 NC_007793.3914065.p0 Protein 3e-32 41
afsQ YP_005329855.1 Two component transcriptional regulatory protein afsQ1 NC_002758.1121390.p0 Protein 3e-32 41
afsQ YP_005329855.1 Two component transcriptional regulatory protein afsQ1 NC_010079.5776364.p0 Protein 3e-32 41
afsQ YP_005329855.1 Two component transcriptional regulatory protein afsQ1 NC_002952.2859858.p0 Protein 3e-32 41
afsQ YP_005329855.1 Two component transcriptional regulatory protein afsQ1 NC_007622.3794948.p0 Protein 3e-32 41
afsQ YP_005329855.1 Two component transcriptional regulatory protein afsQ1 NC_003923.1003417.p0 Protein 3e-32 41
afsQ YP_005329855.1 Two component transcriptional regulatory protein afsQ1 NC_013450.8614146.p0 Protein 3e-32 41
afsQ YP_005329855.1 Two component transcriptional regulatory protein afsQ1 CP000647.1.gene2531. Protein 5e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
afsQ YP_005329855.1 Two component transcriptional regulatory protein afsQ1 VFG1390 Protein 1e-27 44
afsQ YP_005329855.1 Two component transcriptional regulatory protein afsQ1 VFG1389 Protein 2e-21 44
afsQ YP_005329855.1 Two component transcriptional regulatory protein afsQ1 VFG1563 Protein 4e-28 43
afsQ YP_005329855.1 Two component transcriptional regulatory protein afsQ1 VFG1702 Protein 6e-28 43