Gene Information

Name : PM3016_6981 (PM3016_6981)
Accession : YP_005316721.1
Strain : Paenibacillus mucilaginosus 3016
Genome accession: NC_016935
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 8198486 - 8199160 bp
Length : 675 bp
Strand : -
Note : -

DNA sequence :
ATGAACATTCTGCTTGCGGAAGACGATGACCGGCTCGGTGAACTCGTCGCACACATGCTGAAGAAGAAAGCGGGATACCG
CGTGGATTGGGTCATGACGGGTGAAGATGCCTACGATTATGCGAAGGCGGCCCATTACGATATTGTGATACTCGATTGGA
TGATGCCCGGTGGCGACGGGGTGGAGGCATGCCGCAGGCTGCGCCGCTCCGGCTACACGGGCGCGGTGCTTATGCTGACA
GCCAAGGATGCGCTGCAGGACCGGATTGAGGGGCTCGATGCGGGGGCGGACGACTACCTCGTGAAGCCGTTCGAGATCGA
TGAGCTGCTGGCCCGCCTGCGTGCGCTCTCCCGGCGCAATTATGCGCCGCTCAAGGAAGAGACGGTGACCATCGGCGGGA
TTCTGCTGAACCGGACAGGCTGTACGGTCCAGCTGGGGGAGGAGACGATCCAGCTGACGCCGCGGGAATTCCAGCTGCTG
GATCTGCTCGCGTGCAACAAAGGGCAGGTGCTGTCGAGGGAGGTGCTGCTGGACCGGATCTGGGGATACGATGCGGAGGT
GTCGGCGAAGACCGTCGACGCCACAGTGAAGCTGCTGCGCAAGAAGCTGGAGCCGCTCGGCGGACAGGAACTGGTGCAGA
GCGTACGCGGGGTGGGATACAAGCTTGAAGACTAG

Protein sequence :
MNILLAEDDDRLGELVAHMLKKKAGYRVDWVMTGEDAYDYAKAAHYDIVILDWMMPGGDGVEACRRLRRSGYTGAVLMLT
AKDALQDRIEGLDAGADDYLVKPFEIDELLARLRALSRRNYAPLKEETVTIGGILLNRTGCTVQLGEETIQLTPREFQLL
DLLACNKGQVLSREVLLDRIWGYDAEVSAKTVDATVKLLRKKLEPLGGQELVQSVRGVGYKLED

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 4e-22 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PM3016_6981 YP_005316721.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 9e-29 44
PM3016_6981 YP_005316721.1 winged helix family two component transcriptional regulator BAC0083 Protein 1e-27 42
PM3016_6981 YP_005316721.1 winged helix family two component transcriptional regulator Y16952.3.orf35.gene. Protein 3e-19 42
PM3016_6981 YP_005316721.1 winged helix family two component transcriptional regulator AF310956.2.orf0.gene Protein 2e-22 41
PM3016_6981 YP_005316721.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-32 41
PM3016_6981 YP_005316721.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-32 41
PM3016_6981 YP_005316721.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-32 41
PM3016_6981 YP_005316721.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-32 41
PM3016_6981 YP_005316721.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-32 41
PM3016_6981 YP_005316721.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-32 41
PM3016_6981 YP_005316721.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-32 41
PM3016_6981 YP_005316721.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 4e-28 41
PM3016_6981 YP_005316721.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PM3016_6981 YP_005316721.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-27 41
PM3016_6981 YP_005316721.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-25 41