Gene Information

Name : GPOL_c49340 (GPOL_c49340)
Accession : YP_005285294.1
Strain : Gordonia polyisoprenivorans VH2
Genome accession: NC_016906
Putative virulence/resistance : Resistance
Product : TerD domain-containing protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5560352 - 5560927 bp
Length : 576 bp
Strand : +
Note : -

DNA sequence :
ATGGGCGTGAGCCTGAGCAAGGGTGGGAACGTCTCGCTGACCAAGGAGGCCCCCGGTCTGACCGCGGTCGCCGTGGGTCT
CGGCTGGGATGCCCGTACCACCACCGGTACCGATTTCGACCTCGACGCCAGCGCCATCGCGCTGGGCACCAACAAGAAGG
TGCTCTCCGATCAGCACTTCGTCTTCTTCAACAACCTGCGCTCGCCGGACGGCTCGATCGAGCACACCGGCGACAACCTG
ACCGGCGAAGGCGAAGGCGACGACGAGGTCATCAACGTCGATCTCGCGGGTGTCCCGCCGGAGATCGACAGCATCGTCTT
CCCCGTCTCGATCTATGACGCCGACGCCCGCAGCCAGTCGTTCGGCCAGGTCCGCAACGCCTACATCCGCGTCGTGAACC
GTGCCGGCGGTGCCGAGATCGCCCGCTACGACCTGTCCGAGGACGCTTCCACCGAAACCGCCATGGTGTTCGGCGAGCTC
TACCGCAACGGTGCGGAGTGGAAGTTCCGTGCCGTCGGCCAGGGCTACGCCTCCGGCCTCGCGGGCATCGCCCGCGACTA
CGGCGTCAACGTCTGA

Protein sequence :
MGVSLSKGGNVSLTKEAPGLTAVAVGLGWDARTTTGTDFDLDASAIALGTNKKVLSDQHFVFFNNLRSPDGSIEHTGDNL
TGEGEGDDEVINVDLAGVPPEIDSIVFPVSIYDADARSQSFGQVRNAYIRVVNRAGGAEIARYDLSEDASTETAMVFGEL
YRNGAEWKFRAVGQGYASGLAGIARDYGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-59 66
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-59 66
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-59 66
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-58 66
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-58 66
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-56 65
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-58 65
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-59 64
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 3e-33 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GPOL_c49340 YP_005285294.1 TerD domain-containing protein BAC0389 Protein 7e-58 64
GPOL_c49340 YP_005285294.1 TerD domain-containing protein BAC0390 Protein 3e-59 63