Name : EKO11_0059 (EKO11_0059) Accession : YP_005275787.1 Strain : Escherichia coli KO11FL Genome accession: NC_016902 Putative virulence/resistance : Virulence Product : phage transcriptional regulator, AlpA Function : - COG functional category : - COG ID : - EC number : - Position : 55286 - 55489 bp Length : 204 bp Strand : + Note : PFAM: Prophage CP4-57 regulatory; KEGG: pmr:PMI3478 phage regulatory protein DNA sequence : ATGAGCACCATTGATATTTATAACGATAAGTTCGTCAGCATGCAGTTCATTACTGAACTGACTGGGTTATCCGATAAATG GTTTTATAAGCTTGCACAGGAAGGTAAGTTTCCAAAACCTGTAAAGTTTGGTCGTAGTTCCCGCTGGATTGAACGTGAAG TAAAAGAATGGTTAGAAGCCCGCATTAATGACTCGAGAGCATAA Protein sequence : MSTIDIYNDKFVSMQFITELTGLSDKWFYKLAQEGKFPKPVKFGRSSRWIEREVKEWLEARINDSRA |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
rox | AAR97599.1 | regulator of excision | Not tested | SHI-1 | Protein | 5e-17 | 57 |
unnamed | CAE85187.1 | hypothetical protein | Not tested | PAI V 536 | Protein | 3e-17 | 57 |
S3190 | NP_838473.1 | hypothetical protein | Not tested | SHI-1 | Protein | 8e-17 | 57 |
SF2987 | NP_708761.1 | hypothetical protein | Not tested | SHI-1 | Protein | 8e-17 | 57 |
ECO103_3577 | YP_003223438.1 | transcriptional regulator | Not tested | LEE | Protein | 4e-17 | 57 |
Z1188 | NP_286723.1 | hypothetical protein | Not tested | TAI | Protein | 5e-12 | 56 |
Z1627 | NP_287131.1 | hypothetical protein | Not tested | TAI | Protein | 5e-12 | 56 |
unnamed | CAI43835.1 | hypothetical protein | Not tested | LEE | Protein | 5e-17 | 56 |
unnamed | ADD91712.1 | putative transcriptional regulator AlpA | Not tested | PAI-I AL862 | Protein | 5e-17 | 56 |
c5192 | NP_757040.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 3e-15 | 55 |
unnamed | CAD33739.1 | hypothetical protein | Not tested | PAI I 536 | Protein | 2e-15 | 55 |
unnamed | AAL08466.1 | unknown | Not tested | SRL | Protein | 7e-17 | 54 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
EKO11_0059 | YP_005275787.1 | phage transcriptional regulator, AlpA | VFG0651 | Protein | 2e-17 | 57 |
EKO11_0059 | YP_005275787.1 | phage transcriptional regulator, AlpA | VFG1480 | Protein | 9e-16 | 55 |
EKO11_0059 | YP_005275787.1 | phage transcriptional regulator, AlpA | VFG1057 | Protein | 3e-17 | 54 |