Gene Information

Name : EKO11_0050 (EKO11_0050)
Accession : YP_005275778.1
Strain : Escherichia coli KO11FL
Genome accession: NC_016902
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 48480 - 48701 bp
Length : 222 bp
Strand : -
Note : PFAM: protein of unknown function DUF987; KEGG: kpe:KPK_4943 hypothetical protein

DNA sequence :
ATGAAAATCATCAGTAAGCGCCAGGCGATGCATATTTATCGTCAGCATCCCGAATCCAAGTTATCTGCCTTCGGTACAGG
TCACTACCAGTGGCATCGCAGTATCTGCCATTACTACGGACGTGAAGTTCAGGATATCAGCGGCGTTCTCGCTGTTTTTG
TTGAACGTCGTCAGGACCGGGCAGGCCCGTACGCCATTCTGCGCAGCGTGACAGTGAACTAA

Protein sequence :
MKIISKRQAMHIYRQHPESKLSAFGTGHYQWHRSICHYYGREVQDISGVLAVFVERRQDRAGPYAILRSVTVN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAK00480.1 unknown Not tested SHI-1 Protein 3e-13 65
yeeT NP_838485.1 hypothetical protein Not tested SHI-1 Protein 8e-16 64
yeeT NP_708771.1 hypothetical protein Not tested SHI-1 Protein 8e-16 64
yeeT CAE85202.1 YeeT protein Not tested PAI V 536 Protein 7e-16 64
unnamed CAD66204.1 hypothetical protein Not tested PAI III 536 Protein 6e-16 64
yeeT CAD42099.1 hypothetical protein Not tested PAI II 536 Protein 6e-16 64
yeeT ADD91701.1 YeeT Not tested PAI-I AL862 Protein 2e-15 62
yeeT AAZ04459.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 2e-15 62
unnamed AAL67344.1 intergenic-region protein Not tested PAI II CFT073 Protein 2e-15 62
yeeT AAK16199.1 YeeT Not tested PAI-I AL862 Protein 2e-15 62
aec74 AAW51757.1 Aec74 Not tested AGI-3 Protein 8e-16 62
yeeT CAD33788.1 YeeT protein Not tested PAI I 536 Protein 2e-15 62
c5151 NP_756999.1 hypothetical protein Not tested PAI II CFT073 Protein 3e-15 62
unnamed CAI43847.1 hypothetical protein Not tested LEE Protein 5e-15 61
unnamed AAL08476.1 unknown Not tested SRL Protein 3e-15 61
Z1218 NP_286753.1 hypothetical protein Not tested TAI Protein 5e-15 61
ECO103_3590 YP_003223447.1 hypothetical protein Not tested LEE Protein 2e-14 59
unnamed AAL57578.1 unknown Not tested LEE Protein 1e-12 58
unnamed CAI43902.1 hypothetical protein Not tested LEE Protein 1e-12 58

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EKO11_0050 YP_005275778.1 hypothetical protein VFG1618 Protein 2e-16 64
EKO11_0050 YP_005275778.1 hypothetical protein VFG1679 Protein 3e-16 64
EKO11_0050 YP_005275778.1 hypothetical protein VFG0661 Protein 2e-16 64
EKO11_0050 YP_005275778.1 hypothetical protein VFG1529 Protein 1e-15 62
EKO11_0050 YP_005275778.1 hypothetical protein VFG1067 Protein 1e-15 61