Gene Information

Name : EKO11_0048 (EKO11_0048)
Accession : YP_005275776.1
Strain : Escherichia coli KO11FL
Genome accession: NC_016902
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 47729 - 48049 bp
Length : 321 bp
Strand : -
Note : PFAM: protein of unknown function DUF1219; KEGG: eay:EAM_3020 hypothetical protein

DNA sequence :
ATGAATACTCCAACTGTACCGGCAACGGTGACGGTTTCGTCACGCCTGTCTCCTGTCCAAGTTTGGCAAAAACTATTAAC
GTATATTTTAGAGCATCATTACGGCCTCACGATCAACGACACACCGTTCAGTAACGATACGACGATTCAGGAACATATAG
AGGCTGGAGTGAATCTTACTGATGCTGTTAATTTTCTTGTGGAACGATTCGAGCTGGTGCGCATTGACCAGAAGGGTTTC
TCCTGGCAGGATCAAGAACCCTGGATAACATCTTTGGATGTTCGTCGTGCACAGTTCAACCTTGGCTTGAAACGCTCATA
A

Protein sequence :
MNTPTVPATVTVSSRLSPVQVWQKLLTYILEHHYGLTINDTPFSNDTTIQEHIEAGVNLTDAVNFLVERFELVRIDQKGF
SWQDQEPWITSLDVRRAQFNLGLKRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD66207.1 hypothetical protein Not tested PAI III 536 Protein 1e-21 57
yeeV CAE85204.1 YeeV protein Not tested PAI V 536 Protein 1e-20 56
yeeV YP_854325.1 hypothetical protein Not tested PAI I APEC-O1 Protein 8e-21 56
unnamed CAD42101.1 hypothetical protein Not tested PAI II 536 Protein 9e-21 56
unnamed AAL67342.1 intergenic-region protein Not tested PAI II CFT073 Protein 9e-21 56
unnamed AAL57575.1 unknown Not tested LEE Protein 5e-21 56
unnamed CAI43848.1 hypothetical protein Not tested LEE Protein 3e-20 56
aec76 AAW51759.1 Aec76 Not tested AGI-3 Protein 3e-20 56
z5091 CAD33789.1 Z5091 protein Not tested PAI I 536 Protein 2e-20 55
unnamed AAL08478.1 unknown Not tested SRL Protein 7e-20 55
yeeV NP_838487.1 hypothetical protein Not tested SHI-1 Protein 1e-20 55
yeeV NP_708773.1 hypothetical protein Not tested SHI-1 Protein 1e-20 55
unnamed AAK00482.1 unknown Not tested SHI-1 Protein 7e-21 55
ECs4539 NP_312566.1 hypothetical protein Not tested LEE Protein 9e-20 54
unnamed AAC31486.1 L0007 Not tested LEE Protein 6e-20 54
unnamed ACU09433.1 conserved hypothetical protein Not tested LEE Protein 6e-20 54
Z5091 NP_290242.1 hypothetical protein Not tested LEE Protein 9e-20 54
yeeV ADD91699.1 YeeV Not tested PAI-I AL862 Protein 1e-19 54

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EKO11_0048 YP_005275776.1 hypothetical protein VFG1682 Protein 6e-22 57
EKO11_0048 YP_005275776.1 hypothetical protein VFG1620 Protein 4e-21 56
EKO11_0048 YP_005275776.1 hypothetical protein VFG1069 Protein 3e-20 55
EKO11_0048 YP_005275776.1 hypothetical protein VFG1530 Protein 8e-21 55
EKO11_0048 YP_005275776.1 hypothetical protein VFG0663 Protein 3e-21 55
EKO11_0048 YP_005275776.1 hypothetical protein VFG0786 Protein 2e-20 54