Gene Information

Name : EKO11_4031 (EKO11_4031)
Accession : YP_005279664.1
Strain : Escherichia coli KO11FL
Genome accession: NC_016902
Putative virulence/resistance : Virulence
Product : phage transcriptional regulator, AlpA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4242635 - 4242853 bp
Length : 219 bp
Strand : +
Note : PFAM: Prophage CP4-57 regulatory; KEGG: ypy:YPK_3140 phage transcriptional regulator, AlpA

DNA sequence : 
ATGAACAATCAACCGAATACCGATACTGACCTGATGAATGACAAACTGGTGACGATGGCATTTATTACCACGTTTACTGG
CCTGACCGACAAATGGTTTTATAAACTGATTAGTGAAGGAAAGTTTCCAAAGCCTATCAAACTGGGGCGTAGTTCCCGCT
GGCGGGAAAGTGAAGTTAAACGCTGGCTGACGGAACGTATTGCAGAATCCCGCTATTAA

Protein sequence : 
MNNQPNTDTDLMNDKLVTMAFITTFTGLTDKWFYKLISEGKFPKPIKLGRSSRWRESEVKRWLTERIAESRY

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 1e-17 72
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 9e-18 72
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 7e-18 70
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 9e-18 69
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 6e-18 69
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 1e-17 69
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 1e-17 69
unnamed CAI43835.1 hypothetical protein Not tested LEE Protein 1e-17 68
unnamed ADD91712.1 putative transcriptional regulator AlpA Not tested PAI-I AL862 Protein 1e-17 68
unnamed AAL08466.1 unknown Not tested SRL Protein 2e-17 66

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EKO11_4031 YP_005279664.1 phage transcriptional regulator, AlpA VFG1480 Protein 4e-18 72
EKO11_4031 YP_005279664.1 phage transcriptional regulator, AlpA VFG0651 Protein 4e-18 69
EKO11_4031 YP_005279664.1 phage transcriptional regulator, AlpA VFG1057 Protein 6e-18 66