Gene Information

Name : Awo_c27260 (Awo_c27260)
Accession : YP_005270368.1
Strain : Acetobacterium woodii DSM 1030
Genome accession: NC_016894
Putative virulence/resistance : Virulence
Product : response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3188526 - 3189218 bp
Length : 693 bp
Strand : -
Note : -

DNA sequence :
ATGATATTGATCAAAAAAGACATTCTGATTATCGAAGATGACCGTTCAATTGTACGAATCCTGGAATTGGAGTTAAAATA
TGAAGGGTATACATATGACAGTGCTTATGACGGAAAAGAAGGACTGAAAAAATTTAATAATAACGAATATGGATTAATTC
TTTTGGATTTAATGCTTCCCGAAGTCAGTGGAATGGAAGTGTGTCGAAAAATTCGCAAGCATTCGATGGTGCCAATCATC
ATGCTAACGGCAAGAAGGGATATAACCGACAAAGTCATTGGTTTGGATCTGGGGGCCAATGATTATGTTACAAAACCCTT
TGAAATAGAAGAATTGCTGGCCAGAATTAGAGCTGGCCTCAGACATGGACTGGCCAGAATGACGGCAGTAAAATTGATAA
AGGTTTCGGATCTGTCCATTAATTTGTCAACCAGGGAAGTTTTAAAACAGGCAGATTCAATAGATTTGACAAAAACAGAA
TATGAGCTACTGGAATACTTAATGATTAATAAAGGCCGGGTCTTAACCCGCGATCAAATTATTGAGCAGGTATGGGGTTA
TGATTTTGAAGGCGACACGAATATTCTGGATGTCTATATCCGCTATCTCAGAAATAAAATTGATAATCCCTATGGGACAA
AGCTCATTCACACCGTTAGAGGAGTCGGCTACATCATTAAGGAGCAAAGATGA

Protein sequence :
MILIKKDILIIEDDRSIVRILELELKYEGYTYDSAYDGKEGLKKFNNNEYGLILLDLMLPEVSGMEVCRKIRKHSMVPII
MLTARRDITDKVIGLDLGANDYVTKPFEIEELLARIRAGLRHGLARMTAVKLIKVSDLSINLSTREVLKQADSIDLTKTE
YELLEYLMINKGRVLTRDQIIEQVWGYDFEGDTNILDVYIRYLRNKIDNPYGTKLIHTVRGVGYIIKEQR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-33 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Awo_c27260 YP_005270368.1 response regulator NC_010079.5776364.p0 Protein 2e-47 53
Awo_c27260 YP_005270368.1 response regulator NC_002952.2859858.p0 Protein 2e-47 53
Awo_c27260 YP_005270368.1 response regulator NC_007622.3794948.p0 Protein 2e-47 53
Awo_c27260 YP_005270368.1 response regulator NC_003923.1003417.p0 Protein 2e-47 53
Awo_c27260 YP_005270368.1 response regulator NC_013450.8614146.p0 Protein 2e-47 53
Awo_c27260 YP_005270368.1 response regulator NC_002951.3238224.p0 Protein 2e-47 53
Awo_c27260 YP_005270368.1 response regulator NC_007793.3914065.p0 Protein 2e-47 53
Awo_c27260 YP_005270368.1 response regulator NC_002758.1121390.p0 Protein 2e-47 53
Awo_c27260 YP_005270368.1 response regulator AE015929.1.gene1106. Protein 1e-39 49
Awo_c27260 YP_005270368.1 response regulator HE999704.1.gene1528. Protein 4e-37 49
Awo_c27260 YP_005270368.1 response regulator BAC0197 Protein 2e-38 46
Awo_c27260 YP_005270368.1 response regulator BAC0347 Protein 3e-31 45
Awo_c27260 YP_005270368.1 response regulator BAC0125 Protein 1e-39 44
Awo_c27260 YP_005270368.1 response regulator NC_002952.2859905.p0 Protein 6e-35 44
Awo_c27260 YP_005270368.1 response regulator NC_002758.1121668.p0 Protein 7e-35 44
Awo_c27260 YP_005270368.1 response regulator NC_009641.5332272.p0 Protein 7e-35 44
Awo_c27260 YP_005270368.1 response regulator NC_013450.8614421.p0 Protein 7e-35 44
Awo_c27260 YP_005270368.1 response regulator NC_007793.3914279.p0 Protein 7e-35 44
Awo_c27260 YP_005270368.1 response regulator NC_003923.1003749.p0 Protein 8e-35 44
Awo_c27260 YP_005270368.1 response regulator NC_002745.1124361.p0 Protein 7e-35 44
Awo_c27260 YP_005270368.1 response regulator NC_009782.5559369.p0 Protein 7e-35 44
Awo_c27260 YP_005270368.1 response regulator NC_002951.3237708.p0 Protein 7e-35 44
Awo_c27260 YP_005270368.1 response regulator NC_007622.3794472.p0 Protein 6e-35 44
Awo_c27260 YP_005270368.1 response regulator BAC0111 Protein 1e-33 44
Awo_c27260 YP_005270368.1 response regulator BAC0308 Protein 2e-33 43
Awo_c27260 YP_005270368.1 response regulator HE999704.1.gene2815. Protein 2e-29 43
Awo_c27260 YP_005270368.1 response regulator NC_012469.1.7685629. Protein 5e-34 42
Awo_c27260 YP_005270368.1 response regulator NC_014475.1.orf0.gen Protein 2e-28 41
Awo_c27260 YP_005270368.1 response regulator NC_005054.2598277.p0 Protein 2e-28 41
Awo_c27260 YP_005270368.1 response regulator BAC0083 Protein 8e-36 41
Awo_c27260 YP_005270368.1 response regulator BAC0638 Protein 9e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Awo_c27260 YP_005270368.1 response regulator VFG1390 Protein 2e-40 45
Awo_c27260 YP_005270368.1 response regulator VFG0596 Protein 4e-34 42
Awo_c27260 YP_005270368.1 response regulator VFG1389 Protein 8e-35 41