Gene Information

Name : terE (NOCYR_5457)
Accession : YP_005266834.1
Strain : Nocardia cyriacigeorgica GUH-2
Genome accession: NC_016887
Putative virulence/resistance : Resistance
Product : Tellurium resistance protein terE
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 6070615 - 6071190 bp
Length : 576 bp
Strand : +
Note : Evidence 2b : Function of strongly homologous gene; Product type f : factor

DNA sequence :
ATGGGTGTCAGTTTGTCCAAGGGCGGCAACGTCTCGCTGACCAAGGCGGCGCCTAACCTGACCGCTGTCGCGGTCGGCCT
CGGCTGGGACGTTCGTACCACCACCGGCACGGACTTCGACCTCGACGCCAGCGCGATCGCGACCGGAGCCGACAAGAAGG
TGGTCTCCGACCAGCACTTCGTCTTCTTCAACAACCTGCGCTCGCCGGAAGGCACCATCGAGCACATCGGCGACAACACC
ACCGGTGAAGGCGAGGGCGACGACGAGGTCATCAACGTCGATCTGGCCAACACCCCGCCCACCATCGAGTCCATCTTCTT
CCCGGTCTCGATCTACGACGCCGATACCCGTCAGCAGTCGTTCGGCCAGGTGCGCAACGCCTACATCCGCGTCGTGGACC
GCTCCAACAACGAGGAGCTGGCCCGCTACGACCTGTCCGAGGACGCCTCCACCGAGACCGCCATGGTGTTCGGTGAGCTG
TACCGCAACGGCGCCGAATGGAAGTTCCGCGCCATCGGCCAGGGCTACGCCTCCGGCCTGGCCGGCATCGCCCGCGACTA
CGGCGTGAACGTCTGA

Protein sequence :
MGVSLSKGGNVSLTKAAPNLTAVAVGLGWDVRTTTGTDFDLDASAIATGADKKVVSDQHFVFFNNLRSPEGTIEHIGDNT
TGEGEGDDEVINVDLANTPPTIESIFFPVSIYDADTRQQSFGQVRNAYIRVVDRSNNEELARYDLSEDASTETAMVFGEL
YRNGAEWKFRAIGQGYASGLAGIARDYGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-50 61
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-50 61
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-50 61
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-50 60
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-50 60
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 8e-50 60
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-50 59
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-48 59
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-25 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
terE YP_005266834.1 Tellurium resistance protein terE BAC0390 Protein 4e-50 59
terE YP_005266834.1 Tellurium resistance protein terE BAC0389 Protein 8e-50 59