Gene Information

Name : NOCYR_4742 (NOCYR_4742)
Accession : YP_005266130.1
Strain : Nocardia cyriacigeorgica GUH-2
Genome accession: NC_016887
Putative virulence/resistance : Virulence
Product : putative two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5237950 - 5238636 bp
Length : 687 bp
Strand : -
Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId : 15601704, 11675502, 14638785; Product type pr : putative regulator

DNA sequence :
ATGCGCATTCTGGTAGTCGACGACGATCGCGCCGTCCGGGAATCGCTGCGGCGGTCGCTGACCTTCAACGGCTACACCGT
CGACCTCGCGGTCGATGGTGTCGACGCACTGGACAAAGTCACCGCGCAACGACCGGACGCGCTCGTGCTCGATGTGATGA
TGCCGCGCCTGGACGGCCTGGAGGTTTGCCGCCGTTTGCGCAGCACCGGCGACGATCTGCCGATTCTGGTTTTGACCGCC
CGGGATTCGGTTTCCGAACGGGTGGCCGGGCTCGACGCGGGCGCCGACGACTATTTGCCGAAACCATTCGCGCTCGAAGA
ATTGCTCGCCCGGTTGCGCGCGTTGCTGCGCCGTCGCGCCAGCGACCCGGGTGAGACATCGGAAACGATGCGGTTCGCCG
ATCTGTCGCTGGATCCGGTCACCCGTGAGGTGTTGCGTGGATCTCGGTCGATCAGCCTCACCCGCACCGAGTTCTCACTG
CTGGAAATGTTGATGGCCAATCCGCGCCGGGTGCTGACCCGCGGCCGGATTCTGGAAGAGGTCTGGGGCTACGACTTCCC
GACCTCCGGCAATGCGCTCGAGGTCTACATCGGCTATCTGCGGCGCAAGACCGAGGCCGAGGGCGAGCCGCGGTTGATCC
ACACGGTGCGCGGGGTCGGCTACGTACTGCGGGAGACACCGCCGTAG

Protein sequence :
MRILVVDDDRAVRESLRRSLTFNGYTVDLAVDGVDALDKVTAQRPDALVLDVMMPRLDGLEVCRRLRSTGDDLPILVLTA
RDSVSERVAGLDAGADDYLPKPFALEELLARLRALLRRRASDPGETSETMRFADLSLDPVTREVLRGSRSISLTRTEFSL
LEMLMANPRRVLTRGRILEEVWGYDFPTSGNALEVYIGYLRRKTEAEGEPRLIHTVRGVGYVLRETPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-26 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NOCYR_4742 YP_005266130.1 putative two-component system response regulator BAC0125 Protein 1e-30 46
NOCYR_4742 YP_005266130.1 putative two-component system response regulator BAC0638 Protein 3e-27 46
NOCYR_4742 YP_005266130.1 putative two-component system response regulator HE999704.1.gene1528. Protein 2e-34 44
NOCYR_4742 YP_005266130.1 putative two-component system response regulator BAC0197 Protein 5e-27 44
NOCYR_4742 YP_005266130.1 putative two-component system response regulator AE000516.2.gene3505. Protein 2e-30 44
NOCYR_4742 YP_005266130.1 putative two-component system response regulator BAC0308 Protein 2e-29 43
NOCYR_4742 YP_005266130.1 putative two-component system response regulator BAC0111 Protein 8e-30 43
NOCYR_4742 YP_005266130.1 putative two-component system response regulator BAC0083 Protein 2e-31 42
NOCYR_4742 YP_005266130.1 putative two-component system response regulator U82965.2.orf14.gene. Protein 1e-19 42
NOCYR_4742 YP_005266130.1 putative two-component system response regulator NC_003923.1003417.p0 Protein 3e-28 41
NOCYR_4742 YP_005266130.1 putative two-component system response regulator NC_013450.8614146.p0 Protein 3e-28 41
NOCYR_4742 YP_005266130.1 putative two-component system response regulator NC_002951.3238224.p0 Protein 3e-28 41
NOCYR_4742 YP_005266130.1 putative two-component system response regulator NC_007793.3914065.p0 Protein 3e-28 41
NOCYR_4742 YP_005266130.1 putative two-component system response regulator NC_002758.1121390.p0 Protein 3e-28 41
NOCYR_4742 YP_005266130.1 putative two-component system response regulator NC_010079.5776364.p0 Protein 3e-28 41
NOCYR_4742 YP_005266130.1 putative two-component system response regulator NC_002952.2859858.p0 Protein 3e-28 41
NOCYR_4742 YP_005266130.1 putative two-component system response regulator NC_007622.3794948.p0 Protein 3e-28 41
NOCYR_4742 YP_005266130.1 putative two-component system response regulator AE015929.1.gene1106. Protein 3e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NOCYR_4742 YP_005266130.1 putative two-component system response regulator VFG1390 Protein 1e-77 86
NOCYR_4742 YP_005266130.1 putative two-component system response regulator VFG1389 Protein 3e-40 54
NOCYR_4742 YP_005266130.1 putative two-component system response regulator VFG1386 Protein 4e-41 51
NOCYR_4742 YP_005266130.1 putative two-component system response regulator VFG0596 Protein 2e-26 42