Gene Information

Name : NOCYR_4662 (NOCYR_4662)
Accession : YP_005266051.1
Strain : Nocardia cyriacigeorgica GUH-2
Genome accession: NC_016887
Putative virulence/resistance : Resistance
Product : putative tellurium resistance protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5123087 - 5123662 bp
Length : 576 bp
Strand : +
Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pcp : putative cell process

DNA sequence :
ATGAGCGTCACACTGGCCAAAGGCGGCAATGTCTCGCTGTCCAAGCAGGCCCCGAATCTGACCAAAGTCACCGTCGGCCT
GGGTTGGGACGTGCGTACCAGCACCGGGGCGGACTACGACCTCGACGCCAGTGCGCTGGCCACCGGACCCGATCTGAAAG
TGCTGTCGGACCAGCATTTCATCTTCTACAACAACCTGCGCTCGCCGGAGGGATCCATCGAGCACACCGGCGACAACCTC
ACCGGTGAGGGCGACGGCGACGACGAGGTGATCAACGTCGACCTGGCGGCCACCCCGCCGACGATCACCAACATCTTCTT
CCCGGTCTCGATCCACGAGGCCGACGCCCGCAGGCAGTCCTTCGGCCAGGTCCGCAACGCCTACATCCGGGTGCTCGACG
CCGTCACCGGTTCCGAGCTGGCGCGCTACGACCTCAGCGAGGACGCCTCCACCGAGACCGCCATGGTCTTCGGCGAGCTC
TACCGGCACAACGGCGAGTGGAAGTTCCGGGCCATCGGCCAGGGTTACGCCTCCGGGCTGGCCGGGATCGCCCGCGACTA
CGGCGTCAACGTCTGA

Protein sequence :
MSVTLAKGGNVSLSKQAPNLTKVTVGLGWDVRTSTGADYDLDASALATGPDLKVLSDQHFIFYNNLRSPEGSIEHTGDNL
TGEGDGDDEVINVDLAATPPTITNIFFPVSIHEADARRQSFGQVRNAYIRVLDAVTGSELARYDLSEDASTETAMVFGEL
YRHNGEWKFRAIGQGYASGLAGIARDYGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-58 64
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-58 64
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-56 63
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-57 63
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-58 61
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 6e-56 60
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-56 60
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-56 60
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-24 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-24 41
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 3e-28 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NOCYR_4662 YP_005266051.1 putative tellurium resistance protein BAC0389 Protein 2e-57 63
NOCYR_4662 YP_005266051.1 putative tellurium resistance protein BAC0390 Protein 2e-57 58
NOCYR_4662 YP_005266051.1 putative tellurium resistance protein BAC0392 Protein 1e-24 41