Gene Information

Name : NOCYR_4335 (NOCYR_4335)
Accession : YP_005265727.1
Strain : Nocardia cyriacigeorgica GUH-2
Genome accession: NC_016887
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4772423 - 4773100 bp
Length : 678 bp
Strand : -
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 8282725; Product type r : regulator

DNA sequence :
ATGAAGCCGAAGATTCTGGTCGTCGACGACGATATGGCACTCGCGGAGATGCTCACGATCGTCCTGCGCGGGGAAGGGTT
CGACCCGCATGTGGTCGGCGACGGCACGCAGGCGCTGTCGGCGGTCCGGGAAATCCGCCCCGATCTGGTGCTGCTGGACC
TGATGCTGCCGGGTATGAACGGCATCGACGTCTGCCGCGTGCTGCGGGCCGATTCGGGGGTCCCGATCGTGATGCTCACC
GCCAAGACCGACACGGTCGACGTGGTGCTCGGTCTGGAGTCCGGCGCCGACGATTACATCGTCAAACCCTTCAAACCGAA
GGAACTCGTCGCCCGCGTGCGGGCGCGCCTGCGCCGCACCGAGGAGGAGCCCGCCGAGCTGCTCACCATCGCCGACATCG
TCATCGACGTGCCGGCGCACAAGGTGAGCCGCGAAGGTCAGCAGATCTCGCTGACCCCGCTCGAGTTCGACCTGCTGGTG
GCGCTCGCGCGCAAACCGCGGCAGGTGTTCACCCGTGAGGTCCTGCTCGAGCAGGTCTGGGGCTACCGGCACGCCGCCGA
TACCCGCCTGGTGAACGTGCACGTCCAGCGCCTGCGCGCCAAGGTCGAGAAGGATCCCGAGAACCCGGAGATCGTGCTGA
CCGTGCGTGGGGTGGGGTACAAGGCCGGACCGCCGTGA

Protein sequence :
MKPKILVVDDDMALAEMLTIVLRGEGFDPHVVGDGTQALSAVREIRPDLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLT
AKTDTVDVVLGLESGADDYIVKPFKPKELVARVRARLRRTEEEPAELLTIADIVIDVPAHKVSREGQQISLTPLEFDLLV
ALARKPRQVFTREVLLEQVWGYRHAADTRLVNVHVQRLRAKVEKDPENPEIVLTVRGVGYKAGPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-34 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 8e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NOCYR_4335 YP_005265727.1 two-component system response regulator AE000516.2.gene3505. Protein 8e-91 89
NOCYR_4335 YP_005265727.1 two-component system response regulator NC_002952.2859905.p0 Protein 2e-42 46
NOCYR_4335 YP_005265727.1 two-component system response regulator NC_013450.8614421.p0 Protein 2e-42 46
NOCYR_4335 YP_005265727.1 two-component system response regulator NC_007793.3914279.p0 Protein 2e-42 46
NOCYR_4335 YP_005265727.1 two-component system response regulator NC_002745.1124361.p0 Protein 2e-42 46
NOCYR_4335 YP_005265727.1 two-component system response regulator NC_009782.5559369.p0 Protein 2e-42 46
NOCYR_4335 YP_005265727.1 two-component system response regulator NC_002951.3237708.p0 Protein 2e-42 46
NOCYR_4335 YP_005265727.1 two-component system response regulator NC_003923.1003749.p0 Protein 2e-42 46
NOCYR_4335 YP_005265727.1 two-component system response regulator NC_002758.1121668.p0 Protein 2e-42 46
NOCYR_4335 YP_005265727.1 two-component system response regulator NC_007622.3794472.p0 Protein 1e-42 46
NOCYR_4335 YP_005265727.1 two-component system response regulator NC_009641.5332272.p0 Protein 2e-42 46
NOCYR_4335 YP_005265727.1 two-component system response regulator NC_012469.1.7686381. Protein 6e-39 44
NOCYR_4335 YP_005265727.1 two-component system response regulator HE999704.1.gene2815. Protein 1e-37 44
NOCYR_4335 YP_005265727.1 two-component system response regulator AE015929.1.gene1106. Protein 4e-32 43
NOCYR_4335 YP_005265727.1 two-component system response regulator NC_012469.1.7685629. Protein 5e-38 43
NOCYR_4335 YP_005265727.1 two-component system response regulator BAC0125 Protein 9e-31 43
NOCYR_4335 YP_005265727.1 two-component system response regulator BAC0347 Protein 6e-24 42
NOCYR_4335 YP_005265727.1 two-component system response regulator BAC0111 Protein 4e-28 42
NOCYR_4335 YP_005265727.1 two-component system response regulator CP001918.1.gene3444. Protein 3e-37 42
NOCYR_4335 YP_005265727.1 two-component system response regulator NC_002695.1.916589.p Protein 2e-37 42
NOCYR_4335 YP_005265727.1 two-component system response regulator HE999704.1.gene1528. Protein 9e-35 41
NOCYR_4335 YP_005265727.1 two-component system response regulator FJ349556.1.orf0.gene Protein 1e-32 41
NOCYR_4335 YP_005265727.1 two-component system response regulator BAC0197 Protein 1e-27 41
NOCYR_4335 YP_005265727.1 two-component system response regulator CP000034.1.gene3671. Protein 1e-32 41
NOCYR_4335 YP_005265727.1 two-component system response regulator CP001138.1.gene2239. Protein 5e-36 41
NOCYR_4335 YP_005265727.1 two-component system response regulator CP000647.1.gene2531. Protein 5e-36 41
NOCYR_4335 YP_005265727.1 two-component system response regulator BAC0039 Protein 3e-37 41
NOCYR_4335 YP_005265727.1 two-component system response regulator BAC0596 Protein 5e-36 41
NOCYR_4335 YP_005265727.1 two-component system response regulator CP000034.1.gene2186. Protein 3e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NOCYR_4335 YP_005265727.1 two-component system response regulator VFG1390 Protein 1e-32 44
NOCYR_4335 YP_005265727.1 two-component system response regulator VFG1389 Protein 1e-28 44
NOCYR_4335 YP_005265727.1 two-component system response regulator VFG1702 Protein 7e-35 42
NOCYR_4335 YP_005265727.1 two-component system response regulator VFG1563 Protein 4e-35 41