Gene Information

Name : NOCYR_0255 (NOCYR_0255)
Accession : YP_005261720.1
Strain : Nocardia cyriacigeorgica GUH-2
Genome accession: NC_016887
Putative virulence/resistance : Unknown
Product : putative transposase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 289331 - 289648 bp
Length : 318 bp
Strand : +
Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe : putative enzyme

DNA sequence :
GTGAGTTCGAAGAAGTACCCGCAGGAGTTGCGTGAGCGGGCGGTGCGGATGGTCGCGGAGGTCCGCGACCAGCACGAGTC
GGAGTGGGTGGCGATCGGGGCGGTCGCCGAGTTGCTGGGAGTCGGGACCGCGGAGACGGTCCGCAAATGGGTGCGCCAAG
GTCAGGTCGATGCCGGCGCGCGGGCCGGGGTCACCACTGAGGAGTCCGCGGAGCTGAAACGGTTGCGCCGGGAGAACGCG
GAACTCAAGCGCGCCAACGCAATTCTGAAATCGGCGTCGGTTTTCTTCGCGGCCGAACTGGACCGGCCCCAGCGCTGA

Protein sequence :
MSSKKYPQELRERAVRMVAEVRDQHESEWVAIGAVAELLGVGTAETVRKWVRQGQVDAGARAGVTTEESAELKRLRRENA
ELKRANAILKSASVFFAAELDRPQR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
IS629 CAC37925.1 hypothetical protein Not tested LEE Protein 7e-11 49
IS629 CAI43820.1 hypothetical protein Not tested LEE Protein 7e-11 49
Z1199 NP_286734.1 hypothetical protein Not tested TAI Protein 2e-10 49
IS629 CAI43841.1 hypothetical protein Not tested LEE Protein 7e-11 49
Z1222 NP_286757.1 hypothetical protein Not tested TAI Protein 2e-10 49
IS629 CAI43908.1 hypothetical protein 1 Not tested LEE Protein 7e-11 49
Z1639 NP_287142.1 hypothetical protein Not tested TAI Protein 2e-10 49
Z1661 NP_287163.1 hypothetical protein Not tested TAI Protein 2e-10 49
ECO103_3584 YP_003223442.1 IS629 transposase OrfA Not tested LEE Protein 1e-10 49
unnamed CAD42084.1 hypothetical protein Not tested PAI II 536 Protein 4e-07 48
Z4335 NP_289560.1 hypothetical protein Not tested OI-122 Protein 6e-09 48
ECO111_3720 YP_003236060.1 putative IS629 transposase OrfA Not tested LEE Protein 6e-09 48
ECO111_3775 YP_003236110.1 putative IS629 transposase OrfA Not tested LEE Protein 6e-09 48
APECO1_3498 YP_854313.1 transposase; OrfA protein of insertion sequence IS629 Not tested PAI I APEC-O1 Protein 1e-06 48
ORF_36 AAZ04445.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 1e-06 48
r13 AAC61722.1 R13 Not tested PAI I CFT073 Protein 6e-06 47
unnamed AAL67404.1 R13-like protein Not tested PAI II CFT073 Protein 6e-06 47
c5168 NP_757016.1 hypothetical protein Not tested PAI II CFT073 Protein 3e-07 47
c5214 NP_757062.1 hypothetical protein Not tested PAI II CFT073 Protein 3e-07 47
unnamed AAF09023.1 unknown Not tested SHI-O Protein 2e-07 47
S3184 NP_838467.1 IS629 orfA Not tested SHI-1 Protein 3e-07 47
c3596 NP_755471.1 hypothetical protein Not tested PAI I CFT073 Protein 8e-06 47
tnpE AAD44738.1 TnpE Not tested SHI-2 Protein 2e-07 47
SF2979 NP_708753.1 IS629 ORF1 Not tested SHI-1 Protein 3e-07 47
c5177 NP_757025.1 hypothetical protein Not tested PAI II CFT073 Protein 8e-06 47
unnamed AAL67399.1 TnpE-like protein Not tested PAI II CFT073 Protein 2e-07 47
ECUMN_3344 YP_002414020.1 transposase ORF A, IS629 Not tested Not named Protein 8e-06 47
unnamed ADD91740.1 hypothetical protein Not tested PAI-I AL862 Protein 2e-07 47
SF3706 NP_709445.1 IS629 ORF1 Not tested SHI-2 Protein 2e-06 46
S4062 NP_839231.1 IS629 orfA Not tested SHI-2 Protein 7e-06 46
CDC7B_2036 YP_005163477.1 hypothetical protein Not tested Not named Protein 1e-10 44
CDCE8392_1959 YP_005134490.1 hypothetical protein Not tested Not named Protein 4e-11 44

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NOCYR_0255 YP_005261720.1 putative transposase VFG1603 Protein 2e-07 48
NOCYR_0255 YP_005261720.1 putative transposase VFG0643 Protein 8e-08 47
NOCYR_0255 YP_005261720.1 putative transposase VFG1717 Protein 2e-06 47
NOCYR_0255 YP_005261720.1 putative transposase VFG0606 Protein 7e-07 46