Gene Information

Name : fepC (NOCYR_2608)
Accession : YP_005264014.1
Strain : Nocardia cyriacigeorgica GUH-2
Genome accession: NC_016887
Putative virulence/resistance : Virulence
Product : iron-Fe(3+)siderophore transporter subunit ; ATP-binding component of ABC superfamily
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2902814 - 2903680 bp
Length : 867 bp
Strand : -
Note : Evidence 2b : Function of strongly homologous gene; Product type t : transporter

DNA sequence :
GTGAAGACCGGACAAGCCCCGCAGAACGGCTCGCATCGGCTGGCCGCCGACGGCGTGACGCTCGGCTACGGTGAACGGGT
CATCGTCGACGGACTGAGCCTCGACATCGCCCCCGGGGTGATCACCACCGTCATCGGGCCCAACGGCTGCGGCAAGTCCA
CGCTGCTGCGTTCGCTGGGCCGGCTGCTGAAGCCGAGCACCGGGCAGGTGCTGCTCGACGGCAAGGCGATCTCGTCGATG
AAGACCAAGGACGTCGCCCGCATCGTCGGCATGCTGCCGCAGACGCCGGTCGCGCCCGAGGGGCTGACCGTGGCCGATCT
TGTCGCGCGCGGTCGTCATCCGCATCAGTCCTGGATCAAGCAGTGGTCGGCCACCGACGAATCCGAGGTCCTCACCGCAC
TCGAGCAGACCGGCATCGCCGATCTGGCGCATCGCTCGCTCGATGAGCTGTCGGGCGGTCAGCGTCAGCGGGCCTGGATC
TCCATGGCGCTGGCTCAGGGCACCGACATCCTGCTGCTCGACGAGCCGACCACCTACCTGGACCTGGCGCATTCGCTGGA
GGTGCTGGATCTGGTGGACCGGTTGCACGATGAGCTCGGCCGCACCGTGGTGATGGTGCTGCACGATCTCAACCTGGCCA
TCCGCTACAGCGACCAGCTGATCGTCATGCGCGACGGCCGCATCATCGCCCAGGGCGCCGCCGCCGACATCATCGACGCG
GATCTGCTGCGCGAGGTGTTCGGCCTCGAGGCCACCGTGCTGGAAGATCCGATGTCGGGGCGGCCGATGATCGTGCCGAT
CGGCACCAGGCATGTGCTCGGTACGGCCGGCGGACCGGTCGCCGAGGCCGCCACCGACGGAGTATGA

Protein sequence :
MKTGQAPQNGSHRLAADGVTLGYGERVIVDGLSLDIAPGVITTVIGPNGCGKSTLLRSLGRLLKPSTGQVLLDGKAISSM
KTKDVARIVGMLPQTPVAPEGLTVADLVARGRHPHQSWIKQWSATDESEVLTALEQTGIADLAHRSLDELSGGQRQRAWI
SMALAQGTDILLLDEPTTYLDLAHSLEVLDLVDRLHDELGRTVVMVLHDLNLAIRYSDQLIVMRDGRIIAQGAAADIIDA
DLLREVFGLEATVLEDPMSGRPMIVPIGTRHVLGTAGGPVAEAATDGV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
iusE YP_005143742.1 iron ABC transporter ATP-binding protein Virulence Not named Protein 2e-68 58
fecE AAL08451.1 ATP-binding protein FecE Virulence SRL Protein 6e-53 48
SPN23F_09560 YP_002510939.1 ferric siderophore ABC transporter ATP-binding protein Virulence PPI-1 Protein 8e-58 46
SP_1035 NP_345510.1 iron-compound ABC transporter ATP-binding protein Not tested PPI-1 Protein 8e-58 46
fagC YP_005680307.1 ATP binding cytoplasmic membrane protein Not tested PiCp 1 Protein 1e-56 45
fagC YP_003782430.1 ABC transporter ATP-binding protein Not tested PiCp 1 Protein 1e-56 45
fagC YP_005682397.1 ATP binding cytoplasmic membrane protein Virulence PiCp 1 Protein 1e-56 45
fagC YP_005684488.1 ATP binding cytoplasmic membrane protein Not tested PiCp 1 Protein 1e-56 45
ciuD YP_005683346.1 Iron ABC transporter ATP-binding protein Virulence PiCp 4 Protein 2e-49 43
ciuD YP_003783391.1 iron ABC transporter ATP-binding protein Virulence PiCp 4 Protein 2e-49 43
ciuD YP_005685432.1 Iron ABC transporter ATP-binding protein Virulence PiCp 4 Protein 2e-49 43
ciuD YP_005681255.1 Iron ABC transporter ATP-binding protein Virulence PiCp 4 Protein 2e-49 43
DIP0585 NP_938961.1 iron ABC transporter ATP-binding protein Virulence Not named Protein 4e-50 42
CDCE8392_1767 YP_005134301.1 iron complex transport system ATP-binding protein Virulence Not named Protein 2e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
fepC YP_005264014.1 iron-Fe(3+)siderophore transporter subunit ; ATP-binding component of ABC superfamily BAC0164 Protein 3e-53 48

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
fepC YP_005264014.1 iron-Fe(3+)siderophore transporter subunit ; ATP-binding component of ABC superfamily VFG0925 Protein 3e-59 50
fepC YP_005264014.1 iron-Fe(3+)siderophore transporter subunit ; ATP-binding component of ABC superfamily VFG1042 Protein 3e-53 48