Gene Information

Name : Sulac_0734 (Sulac_0734)
Accession : YP_005255913.1
Strain : Sulfobacillus acidophilus DSM 10332
Genome accession: NC_016884
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 737841 - 738518 bp
Length : 678 bp
Strand : +
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; TIGRFAM: phosphate regulon transcriptional regulatory protein PhoB; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DN

DNA sequence :
GTGCCGAGAATTTTAGTAGTCGACGATGAGCCGGCGATTTTAGAATTGGTCTCTTATAATTTGGTGCGCGAAGGGTTTGA
GGTGATCTCCGAACAGGACGGTGAGATGGGCCTCACGCGGGCGATGAACGAATCGTTTGATCTCGTGGTGCTCGATGTGA
TGCTACCCGGGCGCTCGGGCCTGGACGTCTGTCGCGCCATTCGCCAAACCAAGGACATACCGATCATCATGCTGACCGCC
CGCAAAGATGAAGTGGACCGGGTCCTGGGGCTGGAATTGGGGGCAGATGATTATGTGACCAAACCCTTTTCGCCCCGGGA
ACTTGTGGCCCGCGTCAAAGCCATTTTACGCCGGAGCGCCAAGGGGCGCGATACCGGGGATGAAATTCGGTTTCCCGGCT
TGACGATTAATCTTGAGCGCCGGATGGTTACGGTGGACGGTCAGCCGGTTAATCTCACGTTTACGGAATTTGAACTCCTC
ACGATTTTGGCCCGTCATCCCGGGCGGGCTTTTTCCCGCGAGGAGTTACTGGTGCGGGTGTGGGGTGACGATTTTTACGG
CGATTCCCGTACTGTTGACGTGCATGTCCGCCATTTGAGGGAAAAGTTAAAAGAGGATCCGTCGTCCCCTCGGTTTATTG
AAACCGTGAGAGGAGTAGGCTACCGCTTTTGCGACTAA

Protein sequence :
MPRILVVDDEPAILELVSYNLVREGFEVISEQDGEMGLTRAMNESFDLVVLDVMLPGRSGLDVCRAIRQTKDIPIIMLTA
RKDEVDRVLGLELGADDYVTKPFSPRELVARVKAILRRSAKGRDTGDEIRFPGLTINLERRMVTVDGQPVNLTFTEFELL
TILARHPGRAFSREELLVRVWGDDFYGDSRTVDVHVRHLREKLKEDPSSPRFIETVRGVGYRFCD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-36 45
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-36 45
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 5e-30 43
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 5e-30 43
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 5e-30 43
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 5e-30 43
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 5e-30 42
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 8e-29 42
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 2e-28 42
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-29 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 4e-47 51
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 6e-47 51
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 6e-47 51
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 6e-47 51
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 5e-47 51
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 6e-47 51
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-47 51
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 6e-47 51
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 6e-47 51
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 6e-47 51
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 3e-43 49
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 4e-46 48
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 1e-44 48
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 4e-46 47
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-36 46
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator BAC0533 Protein 3e-29 45
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 8e-30 45
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 3e-29 45
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 8e-30 45
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 8e-30 45
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 9e-44 45
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 2e-26 45
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator EU250284.1.orf4.gene Protein 5e-35 45
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-34 45
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-38 44
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-38 44
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-38 44
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-38 44
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-38 44
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-38 44
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-38 44
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-38 44
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 2e-41 44
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 1e-39 44
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 1e-39 44
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 1e-38 44
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 8e-35 44
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 6e-36 44
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 5e-36 44
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator BAC0039 Protein 6e-36 44
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator BAC0596 Protein 6e-36 44
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 6e-36 44
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 1e-34 43
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 9e-33 43
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator AF162694.1.orf4.gene Protein 2e-33 43
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 3e-41 43
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 1e-36 43
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 5e-34 43
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator AF310956.2.orf0.gene Protein 2e-30 42
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator AE016830.1.gene2255. Protein 3e-29 42
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator U35369.1.gene1.p01 Protein 3e-29 42
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator NC_011595.7057856.p0 Protein 1e-33 42
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator NC_010410.6002989.p0 Protein 1e-33 42
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator NC_010400.5986590.p0 Protein 6e-34 42
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 1e-32 42
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 4e-32 42
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator BAC0125 Protein 3e-31 42
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 3e-36 42
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 4e-22 41
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator AF130997.1.orf0.gene Protein 2e-33 41
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator BAC0111 Protein 9e-31 41
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator CP004022.1.gene1676. Protein 1e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator VFG1563 Protein 2e-36 45
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator VFG1702 Protein 2e-36 45
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-30 44
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator VFG1386 Protein 1e-31 44
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator VFG1389 Protein 9e-28 44
Sulac_0734 YP_005255913.1 winged helix family two component transcriptional regulator VFG0596 Protein 1e-29 42