Gene Information

Name : Sulac_1069 (Sulac_1069)
Accession : YP_005256241.1
Strain : Sulfobacillus acidophilus DSM 10332
Genome accession: NC_016884
Putative virulence/resistance : Resistance
Product : copper ion binding protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1075532 - 1075738 bp
Length : 207 bp
Strand : +
Note : PFAM: Heavy-metal-associated domain; TIGRFAM: copper ion binding protein; COGs: COG2608 Copper chaperone; InterPro IPR006122:IPR006121; KEGG: aac:Aaci_1114 heavy metal transport/detoxification protein; PFAM: Heavy metal transport/detoxification protein; S

DNA sequence : 
ATGGAACGGGCCGAATTTGGGGTCAAGGGCATGACGTGTGATCATTGTGTGATGACGGTGACCAAAGCCCTGAAAGGGGT
CGAAGGGGTCAAATTGGCGGAAGTGAGTTTGGCCGAAGAGCGCGCGAAAGTCACCTTTGACCCGACTAAAGCTTCACTGG
AGCAATTAAAAGAAGCCGTCAATCAGGCCGGCTATCAGGCGCTATAG

Protein sequence : 
MERAEFGVKGMTCDHCVMTVTKALKGVEGVKLAEVSLAEERAKVTFDPTKASLEQLKEAVNQAGYQAL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 3e-08 46
merP ABQ57373.1 MerP Not tested SGI1 Protein 2e-08 46
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 2e-08 46
merP AFG30122.1 MerP Not tested PAGI-2 Protein 2e-08 46
merP AGK07023.1 MerP Not tested SGI1 Protein 2e-08 46
merP AGK07081.1 MerP Not tested SGI1 Protein 2e-08 46
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 2e-08 41
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 4e-08 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sulac_1069 YP_005256241.1 copper ion binding protein BAC0085 Protein 5e-06 42
Sulac_1069 YP_005256241.1 copper ion binding protein BAC0679 Protein 2e-08 41
Sulac_1069 YP_005256241.1 copper ion binding protein BAC0231 Protein 3e-08 41
Sulac_1069 YP_005256241.1 copper ion binding protein BAC0678 Protein 1e-08 41