Gene Information

Name : Rahaq2_4971 (Rahaq2_4971)
Accession : YP_005220694.1
Strain :
Genome accession: NC_016835
Putative virulence/resistance : Resistance
Product : DNA-binding domain-containing protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 438839 - 439195 bp
Length : 357 bp
Strand : -
Note : PFAM: Bacterial regulatory helix-turn-helix proteins, AraC family

DNA sequence :
ATGAGAACCGAGGATTTCATTCACGACCTGATCGAGTGGATCGATCACAATCTGGAAGAACGACTGGATATTAAAACGGT
CGCCAAGCGGGCAGGTTATTCCCGCTGGTATCTGCAGCGTATGTTTAAAGAGCACACCGGCTTGCCGATGGGGGAATACA
TTCGTGAGAAAAAACTGAAGAAATCTGCCGATATGCTGGCCAGCAGCGGCGAACCTATCGTCAGCGTTGCGATTTCGCTG
GGCTTCGACTCACAACAGTCTTTCACCCGCAGTTTCAAACGACAGTTTGGTCAGACTCCGGGCGACTGGCGTCGCGGGCT
GAATCTGGCAACTGAATGCCAGGGCTGCCTGCACTAA

Protein sequence :
MRTEDFIHDLIEWIDHNLEERLDIKTVAKRAGYSRWYLQRMFKEHTGLPMGEYIREKKLKKSADMLASSGEPIVSVAISL
GFDSQQSFTRSFKRQFGQTPGDWRRGLNLATECQGCLH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 7e-25 47
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 6e-20 46
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 6e-20 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rahaq2_4971 YP_005220694.1 DNA-binding domain-containing protein CP001918.1.gene327.p Protein 6e-26 48
Rahaq2_4971 YP_005220694.1 DNA-binding domain-containing protein CP000647.1.gene1624. Protein 4e-21 48
Rahaq2_4971 YP_005220694.1 DNA-binding domain-containing protein CP001918.1.gene2033. Protein 2e-21 48
Rahaq2_4971 YP_005220694.1 DNA-binding domain-containing protein CP001138.1.gene4488. Protein 2e-25 47
Rahaq2_4971 YP_005220694.1 DNA-binding domain-containing protein BAC0371 Protein 2e-25 47
Rahaq2_4971 YP_005220694.1 DNA-binding domain-containing protein NC_002695.1.914293.p Protein 2e-25 47
Rahaq2_4971 YP_005220694.1 DNA-binding domain-containing protein NC_002695.1.917339.p Protein 3e-21 47
Rahaq2_4971 YP_005220694.1 DNA-binding domain-containing protein CP001138.1.gene1637. Protein 3e-21 47
Rahaq2_4971 YP_005220694.1 DNA-binding domain-containing protein BAC0560 Protein 3e-21 47
Rahaq2_4971 YP_005220694.1 DNA-binding domain-containing protein CP000034.1.gene1596. Protein 2e-21 47
Rahaq2_4971 YP_005220694.1 DNA-binding domain-containing protein CP000034.1.gene4505. Protein 4e-25 46
Rahaq2_4971 YP_005220694.1 DNA-binding domain-containing protein NC_010558.1.6276025. Protein 3e-20 46
Rahaq2_4971 YP_005220694.1 DNA-binding domain-containing protein CP000647.1.gene4499. Protein 1e-25 44
Rahaq2_4971 YP_005220694.1 DNA-binding domain-containing protein CP001138.1.gene612.p Protein 1e-20 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rahaq2_4971 YP_005220694.1 DNA-binding domain-containing protein VFG0585 Protein 2e-25 47
Rahaq2_4971 YP_005220694.1 DNA-binding domain-containing protein VFG1038 Protein 2e-20 46