Gene Information

Name : STBHUCCB_15310 (STBHUCCB_15310)
Accession : YP_005217083.1
Strain : Salmonella enterica P-stx-12
Genome accession: NC_016832
Putative virulence/resistance : Resistance
Product : Multiple antibiotic resistance protein marA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1483296 - 1483679 bp
Length : 384 bp
Strand : -
Note : similar to DNA-binding transcriptional activator MarA PRK11511; similar to Multiple antibiotic resistance protein marA of Bacteria UniRef RepID=MARA_ECO57

DNA sequence : 
ATGTCCAGACGCAACACTGACGCTATTACTATTCATAGCATTTTGGACTGGATCGAGGATAACCTGGAGTCGCCGCTCTC
ACTGGAAAAAGTGTCTGAGCGTTCAGGATATTCCAAATGGCACCTGCAACGGATGTTTAAAAAAGAGACCGGTCATTCAT
TAGGTCAATACATCCGCAGCCGTAAGATGACGGAAATCGCGCAAAAATTAAAAGAGAGCAACGAGCCCATTCTCTATCTG
GCGGAACGCTATGGCTTTGAGTCACAGCAAACATTGACCCGGACGTTCAAAAACTATTTTGATGTGCCGCCACACAAATA
CCGGATCACCAATATGCATGGCGAATCACGGTATATGCTGCCGCTGAACCATGGCAACTACTAG

Protein sequence : 
MSRRNTDAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPILYL
AERYGFESQQTLTRTFKNYFDVPPHKYRITNMHGESRYMLPLNHGNY

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 6e-21 43
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 6e-21 43
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 2e-19 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
STBHUCCB_15310 YP_005217083.1 Multiple antibiotic resistance protein marA CP001138.1.gene1637. Protein 7e-57 100
STBHUCCB_15310 YP_005217083.1 Multiple antibiotic resistance protein marA BAC0560 Protein 2e-53 96
STBHUCCB_15310 YP_005217083.1 Multiple antibiotic resistance protein marA NC_002695.1.917339.p Protein 2e-53 96
STBHUCCB_15310 YP_005217083.1 Multiple antibiotic resistance protein marA CP000034.1.gene1596. Protein 3e-53 96
STBHUCCB_15310 YP_005217083.1 Multiple antibiotic resistance protein marA CP001918.1.gene2033. Protein 3e-52 95
STBHUCCB_15310 YP_005217083.1 Multiple antibiotic resistance protein marA CP000647.1.gene1624. Protein 1e-51 93
STBHUCCB_15310 YP_005217083.1 Multiple antibiotic resistance protein marA NC_010558.1.6276025. Protein 3e-21 43
STBHUCCB_15310 YP_005217083.1 Multiple antibiotic resistance protein marA CP001138.1.gene612.p Protein 7e-23 42
STBHUCCB_15310 YP_005217083.1 Multiple antibiotic resistance protein marA CP000034.1.gene4505. Protein 3e-19 42
STBHUCCB_15310 YP_005217083.1 Multiple antibiotic resistance protein marA BAC0371 Protein 2e-19 42
STBHUCCB_15310 YP_005217083.1 Multiple antibiotic resistance protein marA CP001138.1.gene4488. Protein 5e-20 42
STBHUCCB_15310 YP_005217083.1 Multiple antibiotic resistance protein marA NC_002695.1.914293.p Protein 2e-19 42
STBHUCCB_15310 YP_005217083.1 Multiple antibiotic resistance protein marA CP001918.1.gene327.p Protein 4e-20 42
STBHUCCB_15310 YP_005217083.1 Multiple antibiotic resistance protein marA CP000647.1.gene4499. Protein 8e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
STBHUCCB_15310 YP_005217083.1 Multiple antibiotic resistance protein marA VFG1038 Protein 2e-21 43
STBHUCCB_15310 YP_005217083.1 Multiple antibiotic resistance protein marA VFG0585 Protein 5e-20 42