Gene Information

Name : soxS (SPUL_4257)
Accession : YP_005215310.1
Strain : Salmonella enterica RKS5078
Genome accession: NC_016831
Putative virulence/resistance : Resistance
Product : regulatory protein SoxS
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4319448 - 4319771 bp
Length : 324 bp
Strand : -
Note : -

DNA sequence :
ATGTCGCATCAGCAGATAATTCAGACCCTTATCGAATGGATTGATGAACATATCGACCAACCGCTAAACATTGATGTGGT
GGCAAAAAAATCGGGCTACTCCAAGTGGTATTTGCAGCGGATGTTTCGTACGGTAACGCATCAAACATTAGGCGAGTATA
TTCGCCAGCGCCGTCTCCTGTTGGCGGCCGTTGAGCTACGAACGACCGAGCGCCCGATTTTTGATATCGCGATGGACCTG
GGCTATGTATCGCAGCAAACCTTCTCGCGTGTATTCCGCCGCGAGTTCGATCGCACTCCCAGCGATTACCGTCACCGCCT
GTAG

Protein sequence :
MSHQQIIQTLIEWIDEHIDQPLNIDVVAKKSGYSKWYLQRMFRTVTHQTLGEYIRQRRLLLAAVELRTTERPIFDIAMDL
GYVSQQTFSRVFRREFDRTPSDYRHRL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 1e-46 100
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 4e-21 50
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 4e-21 50

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
soxS YP_005215310.1 regulatory protein SoxS CP001138.1.gene4488. Protein 5e-47 100
soxS YP_005215310.1 regulatory protein SoxS BAC0371 Protein 7e-46 96
soxS YP_005215310.1 regulatory protein SoxS NC_002695.1.914293.p Protein 7e-46 96
soxS YP_005215310.1 regulatory protein SoxS CP000034.1.gene4505. Protein 1e-45 95
soxS YP_005215310.1 regulatory protein SoxS CP001918.1.gene327.p Protein 4e-45 95
soxS YP_005215310.1 regulatory protein SoxS CP000647.1.gene4499. Protein 3e-44 91
soxS YP_005215310.1 regulatory protein SoxS NC_010558.1.6276025. Protein 2e-21 50
soxS YP_005215310.1 regulatory protein SoxS CP001138.1.gene612.p Protein 4e-25 49
soxS YP_005215310.1 regulatory protein SoxS CP000647.1.gene1624. Protein 7e-20 43
soxS YP_005215310.1 regulatory protein SoxS CP001918.1.gene2033. Protein 4e-20 43
soxS YP_005215310.1 regulatory protein SoxS CP001138.1.gene1637. Protein 5e-20 42
soxS YP_005215310.1 regulatory protein SoxS BAC0560 Protein 4e-20 42
soxS YP_005215310.1 regulatory protein SoxS NC_002695.1.917339.p Protein 4e-20 42
soxS YP_005215310.1 regulatory protein SoxS CP000034.1.gene1596. Protein 4e-20 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
soxS YP_005215310.1 regulatory protein SoxS VFG0585 Protein 4e-47 100
soxS YP_005215310.1 regulatory protein SoxS VFG1038 Protein 2e-21 50