Gene Information

Name : spaP (SPUL_2887)
Accession : YP_005213998.1
Strain : Salmonella enterica RKS5078
Genome accession: NC_016831
Putative virulence/resistance : Virulence
Product : secretory protein (associated with virulence)
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2895595 - 2896269 bp
Length : 675 bp
Strand : -
Note : -

DNA sequence :
ATGGGGAATGATATCTCATTAATTGCCTTACTGGCATTTTCCACCCTGTTGCCATTTATTATTGCGTCAGGAACCTGTTT
CGTTAAATTTTCTATTGTATTTGTCATGGTGCGTAACGCCCTGGGATTGCAGCAGATACCTTCAAATATGACGCTTAACG
GCGTCGCATTGCTGCTTTCTATGTTTGTTATGTGGCCAATAATGCATGATGCCTACGTCTATTTTGAGGACGAAGATGTC
ACCTTTAATGATATTTCGTCATTAAGTAAACACGTTGATGAAGGTCTGGATGGTTATCGCGATTATCTGATCAAATATTC
AGATCGCGAGTTAGTTCAGTTTTTTGAAAACGCGCAACTGAAGCGTCAGTATGGAGAAGAGACCGAGACGGTAAAGCGTG
ACAAAGATGAAATTGAAAAACCATCAATATTTGCGTTATTACCTGCTTATGCGCTGAGCGAAATAAAAAGCGCGTTTAAA
ATTGGTTTTTATCTCTATTTGCCCTTTGTTGTCGTCGACCTGGTGGTATCCAGCGTGCTACTGGCGCTGGGGATGATGAT
GATGAGTCCGGTGACGATATCTACACCTATTAAGTTGGTGCTTTTTGTCGCGCTTGATGGCTGGACCTTACTGTCTAAGG
GATTGATATTACAGTATATGGACATTGCAACATGA

Protein sequence :
MGNDISLIALLAFSTLLPFIIASGTCFVKFSIVFVMVRNALGLQQIPSNMTLNGVALLLSMFVMWPIMHDAYVYFEDEDV
TFNDISSLSKHVDEGLDGYRDYLIKYSDRELVQFFENAQLKRQYGEETETVKRDKDEIEKPSIFALLPAYALSEIKSAFK
IGFYLYLPFVVVDLVVSSVLLALGMMMMSPVTISTPIKLVLFVALDGWTLLSKGLILQYMDIAT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
spaP YP_217809.1 surface presentation of antigens protein SpaP Virulence SPI-1 Protein 6e-86 100
spaP NP_461811.1 surface presentation of antigens protein SpaP Virulence SPI-1 Protein 6e-86 100
spaP NP_457284.1 secretory protein (associated with virulence) Virulence SPI-1 Protein 1e-85 99
spaP NP_806493.1 surface presentation of antigens protein SpaP Virulence SPI-1 Protein 1e-85 99
spaP NP_311752.1 surface presentation of antigens protein SpaP Not tested LIM Protein 5e-56 69
epaP AAZ31293.1 EpaP Virulence ETT2 Protein 2e-54 68
ysaR AAS66846.1 YsaR Not tested SSR-1 Protein 2e-51 60
spaP AAS66865.1 SpaP Not tested SSR-2 Protein 5e-52 60
escR ACU09473.1 type III secretion system protein EscR Virulence LEE Protein 6e-27 45
escR YP_003236103.1 T3SS structure protein EscR Virulence LEE Protein 8e-27 45
escR AAK26700.1 EscR Virulence LEE Protein 5e-27 45
escR NP_290283.1 type III secretion system protein Virulence LEE Protein 8e-27 45
escR AAL57527.1 EscR Virulence LEE Protein 5e-27 45
escR YP_003223490.1 T3SS structure protein EscR Virulence LEE Protein 7e-27 45
escR CAC81847.1 EscR protein Virulence LEE II Protein 5e-27 45
escR YP_003232138.1 type III secretion system protein Virulence LEE Protein 7e-27 45
escR CAI43889.1 EscR protein Virulence LEE Protein 5e-27 45
ECs4583 NP_312610.1 type III secretion system protein Virulence LEE Protein 6e-27 45
escR AAC38369.1 EscR Virulence LEE Protein 3e-26 45
escR AAC31528.1 L0049 Virulence LEE Protein 6e-27 45
lscR AAO18040.1 LscR Virulence TTSS locus Protein 5e-25 44
unnamed AAL06354.1 EscR Virulence LEE Protein 3e-25 44
escR AFO66317.1 putative LEE-encoded type III secretion system factor Virulence SESS LEE Protein 2e-23 43
escR AFO66400.1 putative LEE-encoded type III secretion system factor Virulence SESS LEE Protein 2e-23 43
YPO0270 YP_002345352.1 type III secretion system protein Virulence Not named Protein 2e-25 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
spaP YP_005213998.1 secretory protein (associated with virulence) VFG0551 Protein 2e-86 100
spaP YP_005213998.1 secretory protein (associated with virulence) VFG1012 Protein 2e-48 61
spaP YP_005213998.1 secretory protein (associated with virulence) VFG1773 Protein 1e-52 60
spaP YP_005213998.1 secretory protein (associated with virulence) VFG2455 Protein 4e-48 59
spaP YP_005213998.1 secretory protein (associated with virulence) VFG0394 Protein 1e-27 47
spaP YP_005213998.1 secretory protein (associated with virulence) VFG0715 Protein 1e-26 45
spaP YP_005213998.1 secretory protein (associated with virulence) VFG0827 Protein 3e-27 45
spaP YP_005213998.1 secretory protein (associated with virulence) VFG0188 Protein 3e-26 43