Gene Information

Name : walR (Sinf_1404)
Accession : YP_005204184.1
Strain : Streptococcus infantarius CJ18
Genome accession: NC_016826
Putative virulence/resistance : Virulence
Product : essential two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1433082 - 1433792 bp
Length : 711 bp
Strand : -
Note : -

DNA sequence :
ATGAAAAAAATTCTTATTGTTGATGATGAAAAACCAATTTCAGATATTATTAAATTTAACTTAGCTAAAGAAGGTTATGA
AACTGTTACGGCTTTTGATGGTCGTGAAGCAATTACTAAATTTGAAGAAGAAAATCCTGATTTGATTATCTTGGATTTGA
TGTTGCCAGAATTGGATGGACTTGAAGTTGCAAAAGAAGTTCGTAAAACGAGTCATATTCCTATTATTATGCTTTCTGCA
AAAGATAGTGAGTTCGATAAAGTTATCGGTCTTGAAATCGGTGCAGATGACTACGTCACAAAACCTTTCTCAAATCGTGA
ATTGTTAGCACGTGTCAAAGCACACCTTCGTCGTACTGAGAACATCGAATCAGCTGTCGCTGAGGAAAATGCTTCTTCAT
CAAATTCTGAAATTACCATCGGCGATTTGAAGATTTTGCCTGATGCCTTTGTTGCCCAAAAACGTGGCGAAGACATTGAA
TTAACACACCGTGAATTTGAATTACTTCATCACTTAGCTACTCACATGGGACAAGTGATGACGCGTGAATACCTTTTGGA
GACTGTTTGGGGTTATGATTACTTTGGTGATGTCCGCACGGTTGACGTTACCATCCGTCGTTTACGTGAAAAAATCGAAG
ACACTCCGAGCCGTCCAGAATATATTTTGACACGTCGCGGTGTTGGATACTACATGAAGTCTTATGAATGA

Protein sequence :
MKKILIVDDEKPISDIIKFNLAKEGYETVTAFDGREAITKFEEENPDLIILDLMLPELDGLEVAKEVRKTSHIPIIMLSA
KDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLRRTENIESAVAEENASSSNSEITIGDLKILPDAFVAQKRGEDIE
LTHREFELLHHLATHMGQVMTREYLLETVWGYDYFGDVRTVDVTIRRLREKIEDTPSRPEYILTRRGVGYYMKSYE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-33 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
walR YP_005204184.1 essential two-component response regulator NC_012469.1.7685629. Protein 7e-82 78
walR YP_005204184.1 essential two-component response regulator NC_002952.2859905.p0 Protein 8e-51 52
walR YP_005204184.1 essential two-component response regulator NC_002951.3237708.p0 Protein 1e-50 52
walR YP_005204184.1 essential two-component response regulator NC_003923.1003749.p0 Protein 1e-50 52
walR YP_005204184.1 essential two-component response regulator NC_002758.1121668.p0 Protein 1e-50 52
walR YP_005204184.1 essential two-component response regulator NC_009641.5332272.p0 Protein 1e-50 52
walR YP_005204184.1 essential two-component response regulator NC_013450.8614421.p0 Protein 1e-50 52
walR YP_005204184.1 essential two-component response regulator NC_007793.3914279.p0 Protein 1e-50 52
walR YP_005204184.1 essential two-component response regulator NC_007622.3794472.p0 Protein 8e-51 52
walR YP_005204184.1 essential two-component response regulator NC_002745.1124361.p0 Protein 1e-50 52
walR YP_005204184.1 essential two-component response regulator NC_009782.5559369.p0 Protein 1e-50 52
walR YP_005204184.1 essential two-component response regulator HE999704.1.gene2815. Protein 6e-50 52
walR YP_005204184.1 essential two-component response regulator NC_012469.1.7686381. Protein 2e-42 50
walR YP_005204184.1 essential two-component response regulator AE016830.1.gene1681. Protein 1e-43 46
walR YP_005204184.1 essential two-component response regulator FJ349556.1.orf0.gene Protein 9e-38 45
walR YP_005204184.1 essential two-component response regulator AF155139.2.orf0.gene Protein 7e-37 44
walR YP_005204184.1 essential two-component response regulator AF162694.1.orf4.gene Protein 1e-33 42
walR YP_005204184.1 essential two-component response regulator AM180355.1.gene1830. Protein 3e-35 42
walR YP_005204184.1 essential two-component response regulator DQ212986.1.gene4.p01 Protein 1e-34 42
walR YP_005204184.1 essential two-component response regulator NC_007622.3794948.p0 Protein 3e-35 41
walR YP_005204184.1 essential two-component response regulator NC_003923.1003417.p0 Protein 3e-35 41
walR YP_005204184.1 essential two-component response regulator NC_013450.8614146.p0 Protein 3e-35 41
walR YP_005204184.1 essential two-component response regulator NC_002951.3238224.p0 Protein 3e-35 41
walR YP_005204184.1 essential two-component response regulator NC_007793.3914065.p0 Protein 3e-35 41
walR YP_005204184.1 essential two-component response regulator NC_002758.1121390.p0 Protein 3e-35 41
walR YP_005204184.1 essential two-component response regulator NC_010079.5776364.p0 Protein 3e-35 41
walR YP_005204184.1 essential two-component response regulator NC_002952.2859858.p0 Protein 3e-35 41
walR YP_005204184.1 essential two-component response regulator HE999704.1.gene1528. Protein 6e-33 41
walR YP_005204184.1 essential two-component response regulator NC_005054.2598277.p0 Protein 3e-36 41
walR YP_005204184.1 essential two-component response regulator NC_014475.1.orf0.gen Protein 3e-36 41
walR YP_005204184.1 essential two-component response regulator AE000516.2.gene3505. Protein 2e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
walR YP_005204184.1 essential two-component response regulator VFG1389 Protein 2e-29 43
walR YP_005204184.1 essential two-component response regulator VFG1563 Protein 2e-33 41
walR YP_005204184.1 essential two-component response regulator VFG1702 Protein 2e-33 41