Gene Information

Name : SSON53_03960 (SSON53_03960)
Accession : YP_005455368.1
Strain : Shigella sonnei 53G
Genome accession: NC_016822
Putative virulence/resistance : Unknown
Product : IS911 orf1
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 784033 - 784335 bp
Length : 303 bp
Strand : -
Note : COG2963 Transposase and inactivated derivatives

DNA sequence :
ATGAAAAAAAGAAATTTTAGCGCAGAGTTTAAACGCGAATCCGCTCAACTGGTTGTTGACCAGAAATACACGGTGGCAGA
TGCCGCCAAAGCTATGGATGTTGGCCTTTCCACAATGACAAGATGGGTCAAACAACTGCGTGATGAGCGTCAGGGCAAAA
CACCAAAAGCCTCTCCGATAACACCAGAACAAATCGAAATACGTAAGCTGAGGAAAAAGCTACAACGCATTGAAATGGAG
AATGAAATATTAAAAAAGGCTACCGCGCTCTTGATGTCAGACTCCCTGAACAGTTCTCGATAA

Protein sequence :
MKKRNFSAEFKRESAQLVVDQKYTVADAAKAMDVGLSTMTRWVKQLRDERQGKTPKASPITPEQIEIRKLRKKLQRIEME
NEILKKATALLMSDSLNSSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
l7045 CAD33744.1 - Not tested PAI I 536 Protein 2e-40 97
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 2e-40 97
api80 CAF28554.1 putative transposase Not tested YAPI Protein 3e-34 94
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 8e-39 93
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 8e-31 76
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 8e-31 76
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 8e-31 76
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 8e-31 76
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 8e-31 76
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 8e-31 76
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-30 76
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-30 76
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 4e-29 71
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 9e-24 61
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 6e-24 61
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 2e-22 59
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 3e-22 59
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 3e-22 59
unnamed AAC31483.1 L0004 Not tested LEE Protein 2e-22 59
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 5e-22 56
tnpA CAB61575.1 transposase A Not tested HPI Protein 5e-21 49
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 2e-20 48
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 3e-12 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SSON53_03960 YP_005455368.1 IS911 orf1 VFG1485 Protein 9e-41 97
SSON53_03960 YP_005455368.1 IS911 orf1 VFG1123 Protein 3e-31 76
SSON53_03960 YP_005455368.1 IS911 orf1 VFG1553 Protein 2e-29 71
SSON53_03960 YP_005455368.1 IS911 orf1 VFG0784 Protein 7e-23 59
SSON53_03960 YP_005455368.1 IS911 orf1 VFG1566 Protein 1e-12 42