Gene Information

Name : Rahaq2_1442 (Rahaq2_1442)
Accession : YP_005199461.1
Strain : Rahnella aquatilis CIP 78.65
Genome accession: NC_016818
Putative virulence/resistance : Virulence
Product : heavy metal response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1518754 - 1519428 bp
Length : 675 bp
Strand : +
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; TIGRFAM: heavy metal response regulator

DNA sequence :
ATGCGAATACTGGTGATTGAAGACGATGTCAGTACAGGCGACTACCTGAAAAAAGGGCTGACAGAAGCGGGTTACAGCGT
GGATCTGGCGCGCAACGGTGCCGATGGCCTGTTTCTGGCGCTTGAGGAAGGTTACGACGCGGTGATCCTCGACGTCATGC
TGCCGGGGCTGGACGGCTGGCAGGTGATGGAAGTCCTGCGCAAAAAAAGCGACGTACCGGTGTTGTTTCTCACCGCCCGC
GATGAAGTGCAGGATCGCATTCACGGGCTGGAGCTGGGTGCTGACGATTATCTCATCAAGCCGTTCTCCTTCACCGAACT
GGTGTTGCGTATCCGCACTTTGCTGCGCCGCCCGGCCGCCCGTGAGCCGGATGTGTATTCGGTGGCGGATCTGAATCTTG
ATGTGCTGCGCCGGCGCGTGACCCGTCAGGATCAGACCATCGCGCTGACCAACAAGGAATTCATGTTGTTGCAGTTGCTG
ATGCGCCGCGAGGGCGAGGTGCTGTCGCGCACTATGATTGCCTCCCAGGTCTGGGACATGAATTTCGACAGCGATACCAA
TGTGGTGGATGTCGCCATTAAGCGTCTGCGTGCCAAAGTTGACCGGGCATTTGAGGTGAAACTGATCCACACCGTGCGTG
GCATTGGCTACGTATGCGAAGTGCGACATGAGTGA

Protein sequence :
MRILVIEDDVSTGDYLKKGLTEAGYSVDLARNGADGLFLALEEGYDAVILDVMLPGLDGWQVMEVLRKKSDVPVLFLTAR
DEVQDRIHGLELGADDYLIKPFSFTELVLRIRTLLRRPAAREPDVYSVADLNLDVLRRRVTRQDQTIALTNKEFMLLQLL
MRREGEVLSRTMIASQVWDMNFDSDTNVVDVAIKRLRAKVDRAFEVKLIHTVRGIGYVCEVRHE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-57 57
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-56 56

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rahaq2_1442 YP_005199461.1 heavy metal response regulator BAC0197 Protein 1e-68 65
Rahaq2_1442 YP_005199461.1 heavy metal response regulator BAC0125 Protein 2e-67 64
Rahaq2_1442 YP_005199461.1 heavy metal response regulator BAC0638 Protein 3e-57 62
Rahaq2_1442 YP_005199461.1 heavy metal response regulator BAC0083 Protein 9e-64 61
Rahaq2_1442 YP_005199461.1 heavy metal response regulator BAC0308 Protein 1e-64 60
Rahaq2_1442 YP_005199461.1 heavy metal response regulator BAC0111 Protein 1e-62 57
Rahaq2_1442 YP_005199461.1 heavy metal response regulator BAC0347 Protein 5e-55 52
Rahaq2_1442 YP_005199461.1 heavy metal response regulator U82965.2.orf14.gene. Protein 2e-31 42
Rahaq2_1442 YP_005199461.1 heavy metal response regulator AE000516.2.gene3505. Protein 4e-30 42
Rahaq2_1442 YP_005199461.1 heavy metal response regulator HE999704.1.gene1528. Protein 9e-30 41
Rahaq2_1442 YP_005199461.1 heavy metal response regulator Y16952.3.orf35.gene. Protein 3e-24 41
Rahaq2_1442 YP_005199461.1 heavy metal response regulator NC_002952.2859905.p0 Protein 2e-30 41
Rahaq2_1442 YP_005199461.1 heavy metal response regulator NC_003923.1003749.p0 Protein 3e-30 41
Rahaq2_1442 YP_005199461.1 heavy metal response regulator NC_002745.1124361.p0 Protein 3e-30 41
Rahaq2_1442 YP_005199461.1 heavy metal response regulator NC_009782.5559369.p0 Protein 3e-30 41
Rahaq2_1442 YP_005199461.1 heavy metal response regulator NC_002951.3237708.p0 Protein 3e-30 41
Rahaq2_1442 YP_005199461.1 heavy metal response regulator NC_007622.3794472.p0 Protein 2e-30 41
Rahaq2_1442 YP_005199461.1 heavy metal response regulator NC_002758.1121668.p0 Protein 3e-30 41
Rahaq2_1442 YP_005199461.1 heavy metal response regulator NC_009641.5332272.p0 Protein 3e-30 41
Rahaq2_1442 YP_005199461.1 heavy metal response regulator NC_013450.8614421.p0 Protein 3e-30 41
Rahaq2_1442 YP_005199461.1 heavy metal response regulator NC_007793.3914279.p0 Protein 3e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rahaq2_1442 YP_005199461.1 heavy metal response regulator VFG0596 Protein 2e-57 57
Rahaq2_1442 YP_005199461.1 heavy metal response regulator VFG1390 Protein 2e-40 44
Rahaq2_1442 YP_005199461.1 heavy metal response regulator VFG1386 Protein 5e-35 44
Rahaq2_1442 YP_005199461.1 heavy metal response regulator VFG1389 Protein 6e-35 44