Gene Information

Name : soxS (PANA5342_4137)
Accession : YP_005197567.1
Strain : Pantoea ananatis LMG 5342
Genome accession: NC_016816
Putative virulence/resistance : Resistance
Product : transcriptional activator of superoxide response regulon
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4363296 - 4363721 bp
Length : 426 bp
Strand : +
Note : -

DNA sequence :
ATGATACAAGAAGAGATCATTCATTCACTGACGCACTGGATTGACCAAAACCTGGATAAGAGCCTGTCAATTGACGAAGT
CGCCGCCAAATCAGGCTATTCGAAATGGCATCTGCAACGTATGTTCCGTAGCGTGACGAAACAGACGTTGGGTGGCTATA
TTCGCGAACGCCGCCTGACGCTGGCCGCTGAAGCGCTGCGACAAACGCAGCGGCCGGTGTTTGATATTGCGATGCAATAT
GGCTATGACTCGCAACAGACATTCTCACGCGTTTTTCGTCGCCAGTTTTCACAAACGCCCACGGCTTATCGCCACGCGAT
GCGCCGCCAGGCCATCCAGCGTCCGCGTTTGATGCGCTTTGACTGCAGCGACACGATGACCAGCTTTACCCAGCGGACAA
CGGGAGAATGCTGTCCGGTTAGCTGA

Protein sequence :
MIQEEIIHSLTHWIDQNLDKSLSIDEVAAKSGYSKWHLQRMFRSVTKQTLGGYIRERRLTLAAEALRQTQRPVFDIAMQY
GYDSQQTFSRVFRRQFSQTPTAYRHAMRRQAIQRPRLMRFDCSDTMTSFTQRTTGECCPVS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 1e-33 66
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 2e-23 48
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 2e-23 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
soxS YP_005197567.1 transcriptional activator of superoxide response regulon CP000647.1.gene4499. Protein 8e-35 68
soxS YP_005197567.1 transcriptional activator of superoxide response regulon BAC0371 Protein 1e-33 67
soxS YP_005197567.1 transcriptional activator of superoxide response regulon NC_002695.1.914293.p Protein 1e-33 67
soxS YP_005197567.1 transcriptional activator of superoxide response regulon CP001918.1.gene327.p Protein 8e-35 67
soxS YP_005197567.1 transcriptional activator of superoxide response regulon CP001138.1.gene4488. Protein 4e-34 66
soxS YP_005197567.1 transcriptional activator of superoxide response regulon CP000034.1.gene4505. Protein 2e-33 66
soxS YP_005197567.1 transcriptional activator of superoxide response regulon CP001138.1.gene612.p Protein 4e-27 50
soxS YP_005197567.1 transcriptional activator of superoxide response regulon NC_010558.1.6276025. Protein 1e-23 48

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
soxS YP_005197567.1 transcriptional activator of superoxide response regulon VFG0585 Protein 4e-34 66
soxS YP_005197567.1 transcriptional activator of superoxide response regulon VFG1038 Protein 1e-23 48