Gene Information

Name : soxR (SFHH103_06270)
Accession : YP_005192868.1
Strain :
Genome accession: NC_016815
Putative virulence/resistance : Resistance
Product : Heavy metal-dependent transcription regulator 2
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1511534 - 1511962 bp
Length : 429 bp
Strand : +
Note : -

DNA sequence :
ATGGGCGATCACGCCGGGATGAAGGGCATGCAGCGGGCCGAGCTCGCCCGGAAGACGGGCTGCAATCTGGAGACGGTGCG
CTATTACGAGAAGGTCGGGCTGCTGCCCGAGCCGCCGCGCACGAAGAGCGGCTATCGCAGCTACGACAGCACGCATGAGC
GGCGGCTTCGCTTCGTCCTGCGGGCGCGCGAACTCGGCTTCTCCCTAGACGAAATCCGTGAGCTGCTGCGTCTCGTCGAC
GAGCGCAACCGGCCCTGCGCCGAAGCACGCGACGTCGCTGCCGTCCACCTTGCTGACGTCCAGGCAAAGATCGCCGACCT
GAGGCGCATGGAGCGGCTGCTCAAGGACGTCGTTGCCCAATGCGGCGACGGCACGCTCCCGGAATGTCCGCTGATCGAGA
CGCTGTTCCAGGAGCGAACTGTCAACTGA

Protein sequence :
MGDHAGMKGMQRAELARKTGCNLETVRYYEKVGLLPEPPRTKSGYRSYDSTHERRLRFVLRARELGFSLDEIRELLRLVD
ERNRPCAEARDVAAVHLADVQAKIADLRRMERLLKDVVAQCGDGTLPECPLIETLFQERTVN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 3e-18 44
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 4e-22 43
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 1e-20 43
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 2e-20 43
merR ACK44535.1 MerR Not tested SGI1 Protein 2e-19 42
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 2e-19 42
merR AFG30124.1 MerR Not tested PAGI-2 Protein 2e-19 42
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 3e-19 42
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 6e-22 41
unnamed BAB47646.1 orf2 Not tested Type-III SCCmec Protein 2e-20 41
SE0081 NP_763636.1 hypothetical protein Not tested SCCpbp4 Protein 2e-20 41
merR AGK07025.1 MerR Not tested SGI1 Protein 3e-19 41
merR AGK07083.1 MerR Not tested SGI1 Protein 3e-19 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
soxR YP_005192868.1 Heavy metal-dependent transcription regulator 2 BAC0682 Protein 5e-24 48
soxR YP_005192868.1 Heavy metal-dependent transcription regulator 2 BAC0688 Protein 2e-21 45
soxR YP_005192868.1 Heavy metal-dependent transcription regulator 2 BAC0684 Protein 2e-21 44
soxR YP_005192868.1 Heavy metal-dependent transcription regulator 2 BAC0683 Protein 6e-21 43
soxR YP_005192868.1 Heavy metal-dependent transcription regulator 2 BAC0686 Protein 3e-21 43
soxR YP_005192868.1 Heavy metal-dependent transcription regulator 2 BAC0689 Protein 7e-21 43
soxR YP_005192868.1 Heavy metal-dependent transcription regulator 2 BAC0687 Protein 5e-20 42
soxR YP_005192868.1 Heavy metal-dependent transcription regulator 2 BAC0232 Protein 5e-20 42
soxR YP_005192868.1 Heavy metal-dependent transcription regulator 2 BAC0680 Protein 4e-21 41