Gene Information

Name : aadA25 (Pmu_03420)
Accession : YP_005176241.1
Strain : Pasteurella multocida 36950
Genome accession: NC_016808
Putative virulence/resistance : Resistance
Product : aminoglycoside 3''-O-adenyltransferase protein
Function : -
COG functional category : -
COG ID : -
EC number : 2.7.7.47
Position : 336789 - 337580 bp
Length : 792 bp
Strand : +
Note : -

DNA sequence : 
ATGAGGGAAGCGGTGACCATCGAAATTTCGAACCAACTATCAGAGGTGCTAAGCGTCATTGAGCGCCATCTGGAATCAAC
GTTGCTGGCCGTGCATTTGTACGGCTCCGCAGTGGATGGCGGCCTGAAGCCATACAGCGATATTGATTTGTTGGTTACTG
TGGCCGTAAAGCTTGATGAAACGACGCGGCGAGCATTGCTCAATGATCTTATGGAGGCTTCGGCTTTCCCTGGCGAGAGC
GAGACGCTCCGCGCTATAGAAGTCACCCTTGTCGTGCATGACGACATCATCCCGTGGCGTTATCCGGCTAAGCGCGAGCT
GCAATTTGGAGAATGGCAGCGCAATGACATTCTTGCGGGTATCTTCGAGCCAGCCATGATCGACATTGATCTGGCTATCT
TGCTGACAAAAGCAAGAGAACATAGCGTTGCCTTGGTAGGTCCAGCGGCGGAGGAACTCTTTGATCCGGTTCCTGAACAG
GATCTATTTGAGGCGCTAAATGAAACCTTAACGCTATGGAACTCGCCGCCCGACTGGGCTGGCGATGAGCGAAATGTAGT
GCTTACGTTGTCCCGCATTTGGTACAGCGCAATAACCGGCAAAATCGCGCCGAAGGATGTCGCTGCCGACTGGGCAATAA
AACGCCTACCTGCCCAGTATCAGCCCGTCTTACTTGAAGCTAGACAGGCTTATCTTGGACAAGAAGAAGATCGCTTGGCC
TCGCGCGCAGATCAGTTGGAAGAATTTGTTCACTACGTGAAAGGCGAGATCACCAAGGTAGTCGGCAAATAA

Protein sequence : 
MREAVTIEISNQLSEVLSVIERHLESTLLAVHLYGSAVDGGLKPYSDIDLLVTVAVKLDETTRRALLNDLMEASAFPGES
ETLRAIEVTLVVHDDIIPWRYPAKRELQFGEWQRNDILAGIFEPAMIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQ
DLFEALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAITGKIAPKDVAADWAIKRLPAQYQPVLLEARQAYLGQEEDRLA
SRADQLEEFVHYVKGEITKVVGK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aadA25 YP_005176241.1 aminoglycoside 3''-O-adenyltransferase protein Not tested ICEPmu1 Protein 3e-118 100
aadA2 ACF06158.1 aminoglycoside 3''-adenyltransferase Not tested Tn5036-like Protein 1e-113 96
aadA2 AAK02046.1 streptomycin/spectinomycin resistance protein Not tested SGI1 Protein 6e-113 95
aadA2 AGF35027.1 AadA2 aminoglycoside adenylyltransferase Not tested SGI1 Protein 6e-113 95
unnamed AFV53113.1 AadA1 aminoglycoside (3') adenyltransferase Not tested AbGRI2-1 Protein 4e-111 92
aadA1 YP_005797149.1 aminoglycoside 3'-adenyltransferase Not tested AbaR4e Protein 5e-111 92
aadA1 AGK36646.1 AadA1 aminoglycoside (3')(9) adenylyltransferase Not tested AbaR26 Protein 4e-111 92
aadA1 YP_006098376.1 aminoglycoside adenylyltransferase Not tested Tn2411 Protein 5e-111 92
aadA1 ACN81025.1 AadA1 aminoglycoside (3')(9) adenylyltransferase Not tested AbaR5 Protein 5e-111 92
aadA1 ACY75515.1 aminoglycoside adenyltransferase Not tested Tn6060 Protein 6e-111 92
aadA1 CAD92142.1 aminoglycoside adenyltransferase Not tested Not named Protein 6e-111 92
aadDA1 CAJ77087.1 Aminoglycoside 3-adenylyltransferase Not tested AbaR1 Protein 4e-111 92
aadA1 ACV89835.1 AadA1 aminoglycoside (3')(9) adenylyltransferase Not tested AbaR7 Protein 4e-111 92
aadA1 YP_005797133.1 aminoglycoside 3'-adenyltransferase Not tested AbaR4e Protein 5e-111 92
aadA1 CAJ77048.1 Aminoglycoside adenylyltransferase Not tested AbaR1 Protein 3e-111 92
aadA1 AAL08435.1 streptomycin adenyltransferase AadA1 Not tested SRL Protein 1e-104 88
aadA7 AGK06969.1 aminoglycoside adenyltransferase Not tested SGI1 Protein 4e-91 73
aadA7 AGK07015.1 aminoglycoside adenyltransferase Not tested SGI1 Protein 4e-91 73
aadA7 AGK07073.1 aminoglycoside adenyltransferase Not tested SGI1 Protein 4e-91 73
aadA7 AAR21854.1 aminoglycoside (3'')(9) adenylyltransferase; AAD(3'')(9) Not tested SGI1 Protein 4e-91 73
aadA7 AAT37846.1 aminoglycoside adenyltransferase Not tested Class I integron Protein 4e-91 73
aadA7 AGF35062.1 aminoglycoside adenyltransferase Not tested SGI1 Protein 4e-91 73
aadA7 AGK06932.1 aminoglycoside adenyltransferase Not tested SGI1 Protein 4e-91 73

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
aadA25 YP_005176241.1 aminoglycoside 3''-O-adenyltransferase protein AF047479.2.orf1.gene Protein 5e-115 97
aadA25 YP_005176241.1 aminoglycoside 3''-O-adenyltransferase protein EU118119.1.orf1.gene Protein 4e-113 95
aadA25 YP_005176241.1 aminoglycoside 3''-O-adenyltransferase protein AF174129.3.gene3.p01 Protein 3e-111 95
aadA25 YP_005176241.1 aminoglycoside 3''-O-adenyltransferase protein AF294653.1.gene3.p01 Protein 8e-111 95
aadA25 YP_005176241.1 aminoglycoside 3''-O-adenyltransferase protein AJ704863.gene12.p01 Protein 2e-101 94
aadA25 YP_005176241.1 aminoglycoside 3''-O-adenyltransferase protein AY263741.gene.p01 Protein 2e-111 94
aadA25 YP_005176241.1 aminoglycoside 3''-O-adenyltransferase protein AM932669.1.gene3.p01 Protein 5e-109 93
aadA25 YP_005176241.1 aminoglycoside 3''-O-adenyltransferase protein AJ584652.2.gene7.p01 Protein 1e-109 92
aadA25 YP_005176241.1 aminoglycoside 3''-O-adenyltransferase protein NC_010410.6003168.p0 Protein 2e-111 92
aadA25 YP_005176241.1 aminoglycoside 3''-O-adenyltransferase protein Y18050.2.gene6.p01 Protein 4e-111 92
aadA25 YP_005176241.1 aminoglycoside 3''-O-adenyltransferase protein AF313471.1.gene3.p01 Protein 2e-111 92
aadA25 YP_005176241.1 aminoglycoside 3''-O-adenyltransferase protein AY339625.2.gene17.p0 Protein 2e-111 92
aadA25 YP_005176241.1 aminoglycoside 3''-O-adenyltransferase protein JN596991.2.gene3.p01 Protein 4e-111 92
aadA25 YP_005176241.1 aminoglycoside 3''-O-adenyltransferase protein FR748153.1.gene5.p01 Protein 4e-111 92
aadA25 YP_005176241.1 aminoglycoside 3''-O-adenyltransferase protein AY123251.gene3.p01 Protein 2e-111 92
aadA25 YP_005176241.1 aminoglycoside 3''-O-adenyltransferase protein NC_010410.6003170.p0 Protein 2e-111 92
aadA25 YP_005176241.1 aminoglycoside 3''-O-adenyltransferase protein AJ628353.gene.p01 Protein 7e-83 90
aadA25 YP_005176241.1 aminoglycoside 3''-O-adenyltransferase protein U37105.2.gene4.p01 Protein 3e-95 75
aadA25 YP_005176241.1 aminoglycoside 3''-O-adenyltransferase protein DQ865198.gene.p01 Protein 4e-71 56
aadA25 YP_005176241.1 aminoglycoside 3''-O-adenyltransferase protein AY139598.1.gene2.p01 Protein 1e-70 56
aadA25 YP_005176241.1 aminoglycoside 3''-O-adenyltransferase protein NC_010558.1.6275994. Protein 4e-71 56
aadA25 YP_005176241.1 aminoglycoside 3''-O-adenyltransferase protein NC_003198.gene.p01 Protein 4e-48 45

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
aadA25 YP_005176241.1 aminoglycoside 3''-O-adenyltransferase protein VFG1026 Protein 7e-105 88