Gene Information

Name : DND132_3243 (DND132_3243)
Accession : YP_005169249.1
Strain : Desulfovibrio desulfuricans ND132
Genome accession: NC_016803
Putative virulence/resistance : Resistance
Product : small multidrug resistance protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3633519 - 3633848 bp
Length : 330 bp
Strand : +
Note : PFAM: small multidrug resistance protein; KEGG: spe:Spro_2603 small multidrug resistance protein

DNA sequence :
ATGGGATACGTCTATCTGGCCCTGGCCATCGTCTGCGAAGTCATCGGCACCACCGCGCTCCAGGCGAGCGACGGGTTCAC
CCGCCTCGGCCCGTCCGCCGTGGTGGTGGCCGGGTACGGGCTGGCCTTCTTCCTCCTGGCCCTGGTCCTGCGGACCATCC
CCATGGGCGTGGCCTACGCCATCTGGGCGGGGCTCGGCATCGTGCTCATCGGCCTGGCCGGGGTGGTCGTCTACAAGCAG
TCCCTGGACCTTCCGGCCATGCTCGGCATGGGCCTGATCGTGGCCGGGGTGGCGGTCATCAACATCTTTTCCAAGACCGT
GAGCCACTAA

Protein sequence :
MGYVYLALAIVCEVIGTTALQASDGFTRLGPSAVVVAGYGLAFFLLALVLRTIPMGVAYAIWAGLGIVLIGLAGVVVYKQ
SLDLPAMLGMGLIVAGVAVINIFSKTVSH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-07 55
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 1e-07 55
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 1e-07 55
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-07 55
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-07 55
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 1e-07 55
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 1e-07 55
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-07 55
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 2e-07 55
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 1e-07 55
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 1e-07 55
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-07 55
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 2e-07 55
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 1e-07 55
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 1e-07 55
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-07 55
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-07 55
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 1e-07 55
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 1e-07 55
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 1e-07 55
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 1e-07 55
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 1e-07 55
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-07 55
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 1e-07 55
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 1e-07 55
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 1e-07 55
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 2e-07 55
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 1e-07 55
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 1e-07 55
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 1e-07 55
unnamed CAD42067.1 hypothetical protein Not tested PAI II 536 Protein 4e-08 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DND132_3243 YP_005169249.1 small multidrug resistance protein CP004022.1.gene1549. Protein 4e-13 61
DND132_3243 YP_005169249.1 small multidrug resistance protein BAC0377 Protein 5e-14 59
DND132_3243 YP_005169249.1 small multidrug resistance protein NC_010410.6003348.p0 Protein 6e-13 58
DND132_3243 YP_005169249.1 small multidrug resistance protein BAC0002 Protein 6e-13 58
DND132_3243 YP_005169249.1 small multidrug resistance protein CP001138.1.gene1489. Protein 1e-09 58
DND132_3243 YP_005169249.1 small multidrug resistance protein BAC0324 Protein 1e-10 57
DND132_3243 YP_005169249.1 small multidrug resistance protein BAC0322 Protein 2e-11 55
DND132_3243 YP_005169249.1 small multidrug resistance protein NC_002695.1.913273.p Protein 2e-08 55
DND132_3243 YP_005169249.1 small multidrug resistance protein BAC0323 Protein 5e-08 55
DND132_3243 YP_005169249.1 small multidrug resistance protein BAC0150 Protein 2e-08 54
DND132_3243 YP_005169249.1 small multidrug resistance protein BAC0192 Protein 8e-04 51
DND132_3243 YP_005169249.1 small multidrug resistance protein BAC0139 Protein 8e-07 43
DND132_3243 YP_005169249.1 small multidrug resistance protein BAC0140 Protein 1e-05 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DND132_3243 YP_005169249.1 small multidrug resistance protein VFG1586 Protein 2e-08 43