Gene Information

Name : DND132_2000 (DND132_2000)
Accession : YP_005168009.1
Strain : Desulfovibrio desulfuricans ND132
Genome accession: NC_016803
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2228927 - 2229613 bp
Length : 687 bp
Strand : +
Note : KEGG: dsa:Desal_3695 two component transcriptional regulator, winged helix family; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; SMART: response regulator receiver

DNA sequence :
GTGTCAGCCCAGAAAATCCTGGTGGTCGAAGACCACAGAGACACGCGAGAACTGCTGAAATACAACCTCACCGCCGCCGG
GTTCGACGTGGCCGCCGCCGAGGACGGCCAGCTCGGCCTGAACCTGGCCCACGCCTTCAAGCCCGACATCATCCTGCTCG
ACCTGATGATGCCCGGCACCGACGGCCTGGAAGTCTGCCGCCAGCTCAAGGGCGATCCGGCCACGGCCCGCATCCCGGTG
ATCATGCTCACAGCCAAGGGCGAGGAGGTGGACAAGATCGTCGGCCTGGAGCTCGGGGCGGATGACTACGTGGTCAAGCC
CTTTTCCCCGCGCGAACTGGTCCTGCGCATCAAGGCGATCCTGCGCCGCTACGGCGCACCCGAGCCCAACGCCCCCAAGC
TGTGGGAGCGCGAGGGCTTGCGCATCGACTTCGAGGCGCACCAGATCACCATCGACGGGGAGGAGACGGCCCTGACGGCC
ACGGAATTCAAGCTCCTGACCGTGCTCGTGTCCGGCGCGGGCAAGGTCCAGACCCGCGACAACCTCCTGGACACGGTCTG
GGACACCCACTTCGAGGGCTACTCCCGCACCGTGGACACCCACGTCCGCAGGCTGCGCCAGAAGCTCGGCCCCTACGCCC
CCTGGATCGAGACGATCCGAGGGGTCGGCTACCGCTTCAAGGCGTAG

Protein sequence :
MSAQKILVVEDHRDTRELLKYNLTAAGFDVAAAEDGQLGLNLAHAFKPDIILLDLMMPGTDGLEVCRQLKGDPATARIPV
IMLTAKGEEVDKIVGLELGADDYVVKPFSPRELVLRIKAILRRYGAPEPNAPKLWEREGLRIDFEAHQITIDGEETALTA
TEFKLLTVLVSGAGKVQTRDNLLDTVWDTHFEGYSRTVDTHVRRLRQKLGPYAPWIETIRGVGYRFKA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-28 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 9e-43 49
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 3e-39 45
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-41 43
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-41 43
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 8e-42 43
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-41 43
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-41 43
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-41 43
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-41 43
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-41 43
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-41 43
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-41 43
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-37 43
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-37 42
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-37 42
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-37 42
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-37 42
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-37 42
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-37 42
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-37 42
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-37 42
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator BAC0533 Protein 1e-32 42
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 1e-32 42
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator BAC0197 Protein 1e-30 42
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 1e-33 41
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 8e-32 41
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 2e-32 41
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 8e-32 41
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 7e-37 41
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 4e-32 41
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator BAC0039 Protein 6e-34 41
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 4e-34 41
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 7e-35 41
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 6e-34 41
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 4e-34 41
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator BAC0596 Protein 4e-34 41
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 2e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DND132_2000 YP_005168009.1 winged helix family two component transcriptional regulator VFG0596 Protein 3e-28 41