Gene Information

Name : mtrA (CDHC02_0638)
Accession : YP_005164424.1
Strain : Corynebacterium diphtheriae HC02
Genome accession: NC_016802
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 651644 - 652321 bp
Length : 678 bp
Strand : +
Note : -

DNA sequence :
ATGGCACCGAAAATTTTGGTTGTCGACGATGATCCCGCGATTTCAGAGATGCTGACCATCGTGCTGGAGGCCGAGGGATT
TGAACCGGTCGCGGTCACTGATGGGGCAGTAGCAGTTGATGCCTTTAGGACAGAATCGCCTGATCTAGTCCTACTCGATT
TGATGCTGCCTGGTATGAATGGCATCGACATTTGTAGGATAATCCGGCAGGAATCGGCAGTTCCTATCGTCATGCTCACG
GCGAAAACCGACACCGTGGACGTAGTCCTTGGTTTGGAATCAGGTGCAGATGACTACATCAACAAGCCGTTTAAGCCGAA
AGAACTCATCGCTCGACTACGTGCACGCTTGCGTCGTACAGAGGACTCTCCGTCCGAAACCATTGAGATCGGGGATCTTA
CGATCGACGTCCTAGGCCACGAAGTCACTCGAGGAGATGAGGAAATTCAACTCACTCCTTTAGAGTTTGATTTGCTGCTT
GAGCTTGCAAGCAAACCAGGACAGGTGTTCACACGTGAGGAACTTCTGCAAAAAGTTTGGGGCTACCGTAATGCCTCAGA
CACGAGACTGGTGAATGTCCATGTGCAGCGACTGCGCTCAAAGATCGAGAAAGACCCAGAAAACCCGCACATCGTGTTAA
CAGTGCGCGGAGTGGGGTATAAGACAGGGCAGGAGTAG

Protein sequence :
MAPKILVVDDDPAISEMLTIVLEAEGFEPVAVTDGAVAVDAFRTESPDLVLLDLMLPGMNGIDICRIIRQESAVPIVMLT
AKTDTVDVVLGLESGADDYINKPFKPKELIARLRARLRRTEDSPSETIEIGDLTIDVLGHEVTRGDEEIQLTPLEFDLLL
ELASKPGQVFTREELLQKVWGYRNASDTRLVNVHVQRLRSKIEKDPENPHIVLTVRGVGYKTGQE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-31 44
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-31 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_005164424.1 two-component system response regulator AE000516.2.gene3505. Protein 7e-63 71
mtrA YP_005164424.1 two-component system response regulator NC_012469.1.7685629. Protein 4e-36 48
mtrA YP_005164424.1 two-component system response regulator NC_002952.2859905.p0 Protein 2e-36 47
mtrA YP_005164424.1 two-component system response regulator NC_007793.3914279.p0 Protein 2e-36 47
mtrA YP_005164424.1 two-component system response regulator NC_002745.1124361.p0 Protein 2e-36 47
mtrA YP_005164424.1 two-component system response regulator NC_009782.5559369.p0 Protein 2e-36 47
mtrA YP_005164424.1 two-component system response regulator NC_002951.3237708.p0 Protein 2e-36 47
mtrA YP_005164424.1 two-component system response regulator NC_007622.3794472.p0 Protein 3e-36 47
mtrA YP_005164424.1 two-component system response regulator NC_003923.1003749.p0 Protein 2e-36 47
mtrA YP_005164424.1 two-component system response regulator NC_002758.1121668.p0 Protein 2e-36 47
mtrA YP_005164424.1 two-component system response regulator NC_009641.5332272.p0 Protein 2e-36 47
mtrA YP_005164424.1 two-component system response regulator NC_013450.8614421.p0 Protein 2e-36 47
mtrA YP_005164424.1 two-component system response regulator HE999704.1.gene2815. Protein 1e-34 47
mtrA YP_005164424.1 two-component system response regulator NC_012469.1.7686381. Protein 3e-32 44
mtrA YP_005164424.1 two-component system response regulator CP000675.2.gene1535. Protein 3e-26 42
mtrA YP_005164424.1 two-component system response regulator AF155139.2.orf0.gene Protein 8e-28 42
mtrA YP_005164424.1 two-component system response regulator BAC0125 Protein 2e-25 42
mtrA YP_005164424.1 two-component system response regulator NC_002952.2859858.p0 Protein 1e-28 41
mtrA YP_005164424.1 two-component system response regulator NC_007622.3794948.p0 Protein 1e-28 41
mtrA YP_005164424.1 two-component system response regulator NC_003923.1003417.p0 Protein 1e-28 41
mtrA YP_005164424.1 two-component system response regulator NC_013450.8614146.p0 Protein 1e-28 41
mtrA YP_005164424.1 two-component system response regulator NC_002951.3238224.p0 Protein 1e-28 41
mtrA YP_005164424.1 two-component system response regulator NC_007793.3914065.p0 Protein 1e-28 41
mtrA YP_005164424.1 two-component system response regulator NC_002758.1121390.p0 Protein 1e-28 41
mtrA YP_005164424.1 two-component system response regulator NC_010079.5776364.p0 Protein 1e-28 41
mtrA YP_005164424.1 two-component system response regulator HE999704.1.gene1528. Protein 5e-27 41
mtrA YP_005164424.1 two-component system response regulator BAC0111 Protein 9e-21 41
mtrA YP_005164424.1 two-component system response regulator AE016830.1.gene1681. Protein 7e-33 41
mtrA YP_005164424.1 two-component system response regulator BAC0083 Protein 5e-21 41
mtrA YP_005164424.1 two-component system response regulator CP000034.1.gene3671. Protein 3e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_005164424.1 two-component system response regulator VFG1563 Protein 2e-31 44
mtrA YP_005164424.1 two-component system response regulator VFG1702 Protein 9e-32 44
mtrA YP_005164424.1 two-component system response regulator VFG1390 Protein 1e-26 43
mtrA YP_005164424.1 two-component system response regulator VFG1389 Protein 1e-19 41