Gene Information

Name : CDVA01_2124 (CDVA01_2124)
Accession : YP_005146028.1
Strain : Corynebacterium diphtheriae VA01
Genome accession: NC_016790
Putative virulence/resistance : Resistance
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2321367 - 2321606 bp
Length : 240 bp
Strand : -
Note : -

DNA sequence :

ATGACAACTAGCCGAACCTTCAGCTACAAGCCGCTGTGGAAACTCCTCATCGACAAGGACCTCAACAAAACACAGCTCCA
AGACCTCGCAGGACTCAGCCCCGCCACCATGGCCAAACTTGGCAAAGGTGCAAACGTGACCACCGACGTGCTCCTGCGAA
TTTGCCAGGTCCTCAACTGTCAAATCGGCGACATCGTCGAGGTTGTTCCTACTAAAAAATTGAAAGAAAAAGACGAATGA

Protein sequence :

MTTSRTFSYKPLWKLLIDKDLNKTQLQDLAGLSPATMAKLGKGANVTTDVLLRICQVLNCQIGDIVEVVPTKKLKEKDE

• Homologs from PAI DB

Gene	GenBank Accn	Product	Virulance or Resistance	PAI or REI	Alignment Type	E-val	Identity
Cp1002_1456	YP_005681720.1	hypothetical protein	Not tested	PiCp 5	Protein	8e-13	54
cpfrc_01461	YP_003783861.1	hypothetical protein	Not tested	PiCp 5	Protein	2e-13	53
CpC231_1455	YP_005683818.1	hypothetical protein	Not tested	PiCp 5	Protein	2e-13	53
CpI19_1462	YP_005685904.1	hypothetical protein	Not tested	PiCp 5	Protein	2e-13	53
SPN23F_09520	YP_002510935.1	regulatory protein	Not tested	PPI-1	Protein	4e-09	43
SP_1030	NP_345505.1	hypothetical protein	Not tested	PPI-1	Protein	4e-09	43

• Homologs from CARD and BacMet (resistance genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
CDVA01_2124	YP_005146028.1	hypothetical protein	DQ212986.1.gene3.p01	Protein	3e-15	54