Gene Information

Name : mtrA (CDPW8_0694)
Accession : YP_005142255.1
Strain : Corynebacterium diphtheriae PW8
Genome accession: NC_016789
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 694866 - 695543 bp
Length : 678 bp
Strand : +
Note : -

DNA sequence :
ATGGCACCGAAAATCTTGGTTGTCGACGATGATCCTGCGATTTCAGAGATGCTGACCATCGTGCTGGAGGCCGAGGGATT
TGAGCCGGTCGCGGTCACTGATGGGGCAGTAGCAGTTGATGCCTTTAGGACAGAATCGCCTGATCTAGTCCTACTCGATT
TGATGCTGCCTGGTATGAACGGCATCGACATTTGTAGGATAATCCGGCAGGAATCGGCAGTTCCTATCGTCATGCTCACG
GCGAAAACCGACACCGTGGACGTAGTCCTTGGTTTGGAATCGGGTGCAGATGACTACATCAACAAGCCGTTTAAGCCGAA
AGAACTCATCGCTCGACTACGTGCACGCTTGCGTCGTACAGAGGACTCTCCGTCCGAAACCATTGAGATCGGGGATCTTA
CGATCGACGTCCTAGGCCACGAAGTCACTCGAGGAGATGAGGTAATTCAACTCACTCCTTTAGAGTTTGATTTGCTGCTT
GAGCTTGCAAGCAAACCAGGGCAGGTGTTCACACGTGAGGAACTTCTGCAAAAAGTTTGGGGCTATCGCAATGCCTCAGA
CACGAGACTGGTGAATGTCTATGTGCAGCGACTGCGCTCAAAGATCGAGAAAGACCCAGAAAACCCGCACATCGTGTTAA
CAGTGCGCGGAGTGGGGTATAAGACAGGGCAGGAGTAG

Protein sequence :
MAPKILVVDDDPAISEMLTIVLEAEGFEPVAVTDGAVAVDAFRTESPDLVLLDLMLPGMNGIDICRIIRQESAVPIVMLT
AKTDTVDVVLGLESGADDYINKPFKPKELIARLRARLRRTEDSPSETIEIGDLTIDVLGHEVTRGDEVIQLTPLEFDLLL
ELASKPGQVFTREELLQKVWGYRNASDTRLVNVYVQRLRSKIEKDPENPHIVLTVRGVGYKTGQE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-29 44
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 9e-30 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_005142255.1 two-component system response regulator AE000516.2.gene3505. Protein 2e-61 71
mtrA YP_005142255.1 two-component system response regulator NC_002952.2859905.p0 Protein 1e-35 47
mtrA YP_005142255.1 two-component system response regulator NC_002758.1121668.p0 Protein 7e-36 47
mtrA YP_005142255.1 two-component system response regulator NC_009641.5332272.p0 Protein 7e-36 47
mtrA YP_005142255.1 two-component system response regulator NC_013450.8614421.p0 Protein 7e-36 47
mtrA YP_005142255.1 two-component system response regulator NC_007793.3914279.p0 Protein 7e-36 47
mtrA YP_005142255.1 two-component system response regulator NC_007622.3794472.p0 Protein 1e-35 47
mtrA YP_005142255.1 two-component system response regulator NC_002745.1124361.p0 Protein 7e-36 47
mtrA YP_005142255.1 two-component system response regulator NC_009782.5559369.p0 Protein 7e-36 47
mtrA YP_005142255.1 two-component system response regulator NC_002951.3237708.p0 Protein 7e-36 47
mtrA YP_005142255.1 two-component system response regulator NC_003923.1003749.p0 Protein 6e-36 47
mtrA YP_005142255.1 two-component system response regulator HE999704.1.gene2815. Protein 6e-34 47
mtrA YP_005142255.1 two-component system response regulator NC_012469.1.7685629. Protein 8e-35 47
mtrA YP_005142255.1 two-component system response regulator NC_012469.1.7686381. Protein 1e-31 44
mtrA YP_005142255.1 two-component system response regulator HE999704.1.gene1528. Protein 1e-28 42
mtrA YP_005142255.1 two-component system response regulator BAC0125 Protein 9e-25 42
mtrA YP_005142255.1 two-component system response regulator NC_007793.3914065.p0 Protein 1e-28 41
mtrA YP_005142255.1 two-component system response regulator NC_002758.1121390.p0 Protein 1e-28 41
mtrA YP_005142255.1 two-component system response regulator NC_010079.5776364.p0 Protein 1e-28 41
mtrA YP_005142255.1 two-component system response regulator NC_002952.2859858.p0 Protein 1e-28 41
mtrA YP_005142255.1 two-component system response regulator NC_007622.3794948.p0 Protein 1e-28 41
mtrA YP_005142255.1 two-component system response regulator NC_003923.1003417.p0 Protein 1e-28 41
mtrA YP_005142255.1 two-component system response regulator NC_013450.8614146.p0 Protein 1e-28 41
mtrA YP_005142255.1 two-component system response regulator NC_002951.3238224.p0 Protein 1e-28 41
mtrA YP_005142255.1 two-component system response regulator CP000675.2.gene1535. Protein 9e-26 41
mtrA YP_005142255.1 two-component system response regulator AF155139.2.orf0.gene Protein 2e-26 41
mtrA YP_005142255.1 two-component system response regulator BAC0111 Protein 6e-20 41
mtrA YP_005142255.1 two-component system response regulator AE016830.1.gene1681. Protein 2e-31 41
mtrA YP_005142255.1 two-component system response regulator BAC0083 Protein 2e-20 41
mtrA YP_005142255.1 two-component system response regulator BAC0197 Protein 2e-21 41
mtrA YP_005142255.1 two-component system response regulator CP000034.1.gene3671. Protein 5e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_005142255.1 two-component system response regulator VFG1563 Protein 8e-30 44
mtrA YP_005142255.1 two-component system response regulator VFG1702 Protein 3e-30 44
mtrA YP_005142255.1 two-component system response regulator VFG1390 Protein 2e-27 43
mtrA YP_005142255.1 two-component system response regulator VFG1389 Protein 7e-20 41