Gene Information

Name : BCN_0758 (BCN_0758)
Accession : YP_005103291.1
Strain : Bacillus cereus NC7401
Genome accession: NC_016771
Putative virulence/resistance : Resistance
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 835900 - 836163 bp
Length : 264 bp
Strand : +
Note : similar to gp:AE017000_150 [Bacillus cereus ATCC 14579], percent identity 100 in 87 aa, BLASTP E(): 3e-42

DNA sequence :
ATGGAATATAATCAAGATATGAAAAATAGATTGAAACGTATTGAAGGGCAAGTTCGTGGTGTGCTTCGTATGATGGAAGA
AGGAAAAGATTGCCGAGAGGTTATTACACAGTTAACGGCATCTCGTTCTGCACTTGATCGTACAATTGGACTTGTTGTTG
GAACGAATTTAGAGCAATGCTTGCGTGAACAGTTTGAAAGTGGTAATGGTTCAAATGAAGAGTTAATTAAAGAAGCTGTT
CAATTACTTGTAAAAAGCCGATAA

Protein sequence :
MEYNQDMKNRLKRIEGQVRGVLRMMEEGKDCREVITQLTASRSALDRTIGLVVGTNLEQCLREQFESGNGSNEELIKEAV
QLLVKSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SAV0048 NP_370572.1 hypothetical protein Not tested Type-II SCCmec Protein 4e-19 50
unnamed BAA82170.2 - Not tested Type-II SCCmec Protein 1e-19 50
SA0045 NP_373285.1 hypothetical protein Not tested Type-II SCCmec Protein 4e-19 50
SERP2514 YP_190056.1 hypothetical protein Not tested Type-II SCCmec Protein 4e-19 50
unnamed BAC57484.1 hypothetical protein Not tested Type-IIIinv SCCmec Protein 3e-19 50
unnamed BAA82210.2 - Not tested Type-II SCCmec Protein 3e-19 50
unnamed BAB47614.1 hypothetical protein Not tested Type-III SCCmec Protein 3e-19 50
unnamed BAA86632.1 hypothetical protein Not tested Type-I SCCmec Protein 6e-20 50
SAR0047 YP_039520.1 hypothetical protein Not tested Type-II SCCmec Protein 4e-19 50
SAPIG0063 YP_005732873.1 conserved protein YrkD Not tested Type-V SCCmec Protein 2e-18 48
SACOL0048 YP_184958.1 hypothetical protein Not tested Type-I SCCmec Protein 2e-18 48
unnamed BAB83476.1 - Not tested SCC 12263 Protein 3e-16 47
unnamed BAA94324.1 hypothetical protein Not tested Type-I SCCmec Protein 2e-16 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BCN_0758 YP_005103291.1 hypothetical protein BAC0333 Protein 1e-09 41