Gene Information

Name : BCN_4578 (BCN_4578)
Accession : YP_005107111.1
Strain : Bacillus cereus NC7401
Genome accession: NC_016771
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4407322 - 4408011 bp
Length : 690 bp
Strand : -
Note : similar to gp:AE017039_99 [Bacillus anthracis str. Ames], percent identity 99 in 229 aa, BLASTP E(): e-127

DNA sequence :
TTGAAAAGAATTTTACTAATAGAAGATGAAGTAAGCATTGCAGAATTACAGCGAGATTATTTAGAAATTAATGATTTTCA
AGTTGATGTCGAACATTCAGGAGAAACAGGTTTACAAATGGCCCTGCAAGAAGACTACGATTTAATTATTTTAGATATTA
TGCTTCCGAAAATGAATGGATTTGAAATTTGTAAGCAAATTCGAGCTATAAAAGATATTCCGATTTTACTTGTTTCAGCA
AAAAAAGAAGATATAGATAAAATTCGCGGGCTCGGTTTAGGAGCGGATGATTATATAACGAAACCGTTTAGCCCGAGTGA
ATTAGTCGCAAGGGTAAAAGCGCATATTTCTCGTTATGAAAGATTATTAGGAAATGTAAGTAAGCAACGCGATACGCTAT
ATATTCACGGAATCTCTATTGATCAAAGGGCGAGGAAAGTTTTTATAAACAATGAAGAAGTTGCGTTTACAACGAAGGAA
TTTGATTTATTAACATTCTTTGTCACAAACCCAAATCAAGTATTAAATAAAGAACAGCTATTTGAACGTATTTGGGGATT
AGACTCCGCTGGTGACTTAGCAACTGTTGTCGTTCATATTAGAAAGCTACGTGAAAAAATTGAAAGAGATCCAGCTCACC
CGCAATATATTGAAACGGTATGGGGAGCTGGTTATCGTTTTAACGTGTAG

Protein sequence :
MKRILLIEDEVSIAELQRDYLEINDFQVDVEHSGETGLQMALQEDYDLIILDIMLPKMNGFEICKQIRAIKDIPILLVSA
KKEDIDKIRGLGLGADDYITKPFSPSELVARVKAHISRYERLLGNVSKQRDTLYIHGISIDQRARKVFINNEEVAFTTKE
FDLLTFFVTNPNQVLNKEQLFERIWGLDSAGDLATVVVHIRKLREKIERDPAHPQYIETVWGAGYRFNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 8e-42 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BCN_4578 YP_005107111.1 DNA-binding response regulator AE016830.1.gene1681. Protein 2e-46 46
BCN_4578 YP_005107111.1 DNA-binding response regulator AE015929.1.gene1106. Protein 7e-34 43
BCN_4578 YP_005107111.1 DNA-binding response regulator FJ349556.1.orf0.gene Protein 1e-42 43
BCN_4578 YP_005107111.1 DNA-binding response regulator AM180355.1.gene1830. Protein 5e-39 43
BCN_4578 YP_005107111.1 DNA-binding response regulator NC_002952.2859858.p0 Protein 1e-37 42
BCN_4578 YP_005107111.1 DNA-binding response regulator NC_007622.3794948.p0 Protein 1e-37 42
BCN_4578 YP_005107111.1 DNA-binding response regulator NC_003923.1003417.p0 Protein 1e-37 42
BCN_4578 YP_005107111.1 DNA-binding response regulator NC_013450.8614146.p0 Protein 1e-37 42
BCN_4578 YP_005107111.1 DNA-binding response regulator NC_002951.3238224.p0 Protein 1e-37 42
BCN_4578 YP_005107111.1 DNA-binding response regulator NC_007793.3914065.p0 Protein 1e-37 42
BCN_4578 YP_005107111.1 DNA-binding response regulator NC_002758.1121390.p0 Protein 1e-37 42
BCN_4578 YP_005107111.1 DNA-binding response regulator NC_010079.5776364.p0 Protein 1e-37 42
BCN_4578 YP_005107111.1 DNA-binding response regulator NC_012469.1.7686381. Protein 5e-39 42
BCN_4578 YP_005107111.1 DNA-binding response regulator AF155139.2.orf0.gene Protein 2e-43 42
BCN_4578 YP_005107111.1 DNA-binding response regulator NC_002952.2859905.p0 Protein 2e-41 41
BCN_4578 YP_005107111.1 DNA-binding response regulator NC_002758.1121668.p0 Protein 2e-41 41
BCN_4578 YP_005107111.1 DNA-binding response regulator NC_009641.5332272.p0 Protein 2e-41 41
BCN_4578 YP_005107111.1 DNA-binding response regulator NC_013450.8614421.p0 Protein 2e-41 41
BCN_4578 YP_005107111.1 DNA-binding response regulator AF130997.1.orf0.gene Protein 1e-35 41
BCN_4578 YP_005107111.1 DNA-binding response regulator NC_007793.3914279.p0 Protein 2e-41 41
BCN_4578 YP_005107111.1 DNA-binding response regulator NC_007622.3794472.p0 Protein 2e-41 41
BCN_4578 YP_005107111.1 DNA-binding response regulator NC_002745.1124361.p0 Protein 2e-41 41
BCN_4578 YP_005107111.1 DNA-binding response regulator NC_009782.5559369.p0 Protein 2e-41 41
BCN_4578 YP_005107111.1 DNA-binding response regulator NC_002951.3237708.p0 Protein 2e-41 41
BCN_4578 YP_005107111.1 DNA-binding response regulator NC_003923.1003749.p0 Protein 2e-41 41
BCN_4578 YP_005107111.1 DNA-binding response regulator HE999704.1.gene2815. Protein 2e-40 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BCN_4578 YP_005107111.1 DNA-binding response regulator VFG1563 Protein 5e-42 41