Gene Information

Name : SMA_1570 (SMA_1570)
Accession : YP_005095176.1
Strain : Streptococcus macedonicus ACA-DC 198
Genome accession: NC_016749
Putative virulence/resistance : Virulence
Product : two-component response regulator SA14-24
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1540265 - 1540975 bp
Length : 711 bp
Strand : -
Note : -

DNA sequence :
ATGAAAAAAATTCTTATCGTTGATGATGAAAAACCAATTTCGGATATTATTAAATTTAATTTAACTAAAGAGGGTTATGA
AGCCATAACGGCTTTTGATGGTCGTGAAGCTATTACAAAGTTTGAGGAAGAAGACCCAGATTTGATTATCTTGGATTTGA
TGTTGCCAGAATTGGACGGACTTGAAGTGGCTAAAGAAGTTCGCAAGACAAGTCATATTCCAATCATTATATTGTCTGCT
AAGGATAGCGAGTTTGATAAAGTTATCGGACTTGAAATCGGTGCAGATGACTATGTAACCAAACCATTTTCAAATCGTGA
ATTGTTGGCGCGTGTTAAAGCGCACCTTCGTCGTACAGAAAATATTGAAACAGCAGTTGCTGAAGAAAATGCTTCTGCTT
CAAATTCAGAAATCACAATTGGTGACTTGAAAATCTTACCAGACGCCTTTGTGGCACAAAAACGTGGTGAAGATATCGAA
TTAACACACCGTGAGTTTGAATTGCTTCATCATTTGGCAACACATATGGGACAAGTCATGACCCGTGAATATCTTTTGGA
AACCGTTTGGGGCTATGATTATTTTGGTGATGTGCGTACGGTTGACGTAACCATTCGTCGTTTACGTGAAAAAATCGAAG
ACACACCAAGCCGTCCAGAATATATTTTGACACGTCGTGGTGTTGGGTACTACATGAAGTCATATGAATGA

Protein sequence :
MKKILIVDDEKPISDIIKFNLTKEGYEAITAFDGREAITKFEEEDPDLIILDLMLPELDGLEVAKEVRKTSHIPIIILSA
KDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLRRTENIETAVAEENASASNSEITIGDLKILPDAFVAQKRGEDIE
LTHREFELLHHLATHMGQVMTREYLLETVWGYDYFGDVRTVDVTIRRLREKIEDTPSRPEYILTRRGVGYYMKSYE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 6e-29 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 7e-29 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 NC_012469.1.7685629. Protein 4e-75 77
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 HE999704.1.gene2815. Protein 3e-43 53
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 NC_002952.2859905.p0 Protein 2e-44 52
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 NC_002951.3237708.p0 Protein 2e-44 52
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 NC_002758.1121668.p0 Protein 2e-44 52
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 NC_009641.5332272.p0 Protein 2e-44 52
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 NC_013450.8614421.p0 Protein 2e-44 52
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 NC_007793.3914279.p0 Protein 2e-44 52
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 NC_007622.3794472.p0 Protein 2e-44 52
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 NC_003923.1003749.p0 Protein 2e-44 52
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 NC_002745.1124361.p0 Protein 2e-44 52
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 NC_009782.5559369.p0 Protein 2e-44 52
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 NC_012469.1.7686381. Protein 2e-35 49
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 AE016830.1.gene1681. Protein 2e-39 47
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 AF155139.2.orf0.gene Protein 4e-31 45
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 FJ349556.1.orf0.gene Protein 6e-32 45
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 HE999704.1.gene1528. Protein 1e-26 43
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 AE000516.2.gene3505. Protein 9e-29 43
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 NC_002951.3238224.p0 Protein 2e-30 42
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 NC_007793.3914065.p0 Protein 2e-30 42
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 NC_002758.1121390.p0 Protein 2e-30 42
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 NC_010079.5776364.p0 Protein 2e-30 42
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 NC_002952.2859858.p0 Protein 2e-30 42
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 NC_007622.3794948.p0 Protein 2e-30 42
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 NC_003923.1003417.p0 Protein 2e-30 42
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 NC_013450.8614146.p0 Protein 2e-30 42
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 AM180355.1.gene1830. Protein 6e-29 42
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 DQ212986.1.gene4.p01 Protein 6e-28 42
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 CP001918.1.gene5135. Protein 2e-22 42
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 AE015929.1.gene1106. Protein 3e-25 41
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 NC_005054.2598277.p0 Protein 2e-31 41
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 NC_014475.1.orf0.gen Protein 2e-31 41
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 AF162694.1.orf4.gene Protein 9e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 VFG1389 Protein 2e-25 44
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 VFG1563 Protein 3e-29 42
SMA_1570 YP_005095176.1 two-component response regulator SA14-24 VFG1702 Protein 3e-29 41