Gene Information

Name : PSE_2475 (PSE_2475)
Accession : YP_005081005.1
Strain : Pseudovibrio sp. FO-BEG1
Genome accession: NC_016642
Putative virulence/resistance : Virulence
Product : two component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2614525 - 2615184 bp
Length : 660 bp
Strand : +
Note : -

DNA sequence :
ATGTTGATCGTTGAAGATGATCGCGATTTGAACAGACAGCTATGCGAAGCGTTGGAAGACGCTGGCTACGTTGTCGACAA
AGCATATGACGGCGAGGAAGGTCATTTCCTCGGCGATACCGAACCTTATGACGCTGTCATTCTGGATCTTGGCCTGCCGC
AGATGGATGGCCTCAGTGTACTGGAACGCTGGCGTCGGGACGGTCACTCCATGCCAGTCCTCATCCTCACAGCCCGTGAC
CGCTGGAGTGATAAGGTCGCGGGCATTGATGCAGGCGCTGATGATTACGTTGCCAAGCCGTTCCATATGGAAGAAGTGCT
GGCGCGGGTGAGGGCACTGGTCCGCCGTGCTGCCGGTCTGGCTTCCAACGAGATTTCAATCGGTGACATTGTTCTGGATA
CCAAAGCAGGCAAGGTGACGAAAAACGGCATGTCCGTGAAGCTCACCTCTCACGAGTTCCGCCTGCTGTCCTACCTCATG
CACCACAAAGGCAGAGTGATCTCCAGAACCGAACTGGTCGAGCACCTCTATGATCAGGACTTTGATCGCGACTCTAACAC
CATCGAAGTGTTTGTAGGCCGCCTGCGCAAGAAGTTTGGCAGTTCGTTGATCGAGACCGTGCGTGGTCTGGGCTACAGGT
TACAGGAAGAAGATGCCTGA

Protein sequence :
MLIVEDDRDLNRQLCEALEDAGYVVDKAYDGEEGHFLGDTEPYDAVILDLGLPQMDGLSVLERWRRDGHSMPVLILTARD
RWSDKVAGIDAGADDYVAKPFHMEEVLARVRALVRRAAGLASNEISIGDIVLDTKAGKVTKNGMSVKLTSHEFRLLSYLM
HHKGRVISRTELVEHLYDQDFDRDSNTIEVFVGRLRKKFGSSLIETVRGLGYRLQEEDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-29 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PSE_2475 YP_005081005.1 two component response regulator NC_002695.1.913289.p Protein 3e-33 46
PSE_2475 YP_005081005.1 two component response regulator CP000034.1.gene2022. Protein 1e-33 46
PSE_2475 YP_005081005.1 two component response regulator CP001918.1.gene2526. Protein 1e-32 46
PSE_2475 YP_005081005.1 two component response regulator CP000647.1.gene1136. Protein 7e-34 46
PSE_2475 YP_005081005.1 two component response regulator CP001138.1.gene1939. Protein 3e-33 46
PSE_2475 YP_005081005.1 two component response regulator BAC0530 Protein 6e-34 46
PSE_2475 YP_005081005.1 two component response regulator BAC0487 Protein 8e-29 45
PSE_2475 YP_005081005.1 two component response regulator NC_002516.2.879194.p Protein 8e-36 45
PSE_2475 YP_005081005.1 two component response regulator CP004022.1.gene1005. Protein 2e-36 44
PSE_2475 YP_005081005.1 two component response regulator BAC0197 Protein 3e-30 44
PSE_2475 YP_005081005.1 two component response regulator BAC0347 Protein 5e-27 41
PSE_2475 YP_005081005.1 two component response regulator NC_010079.5776364.p0 Protein 1e-25 41
PSE_2475 YP_005081005.1 two component response regulator NC_002952.2859858.p0 Protein 1e-25 41
PSE_2475 YP_005081005.1 two component response regulator NC_007622.3794948.p0 Protein 1e-25 41
PSE_2475 YP_005081005.1 two component response regulator NC_003923.1003417.p0 Protein 1e-25 41
PSE_2475 YP_005081005.1 two component response regulator NC_013450.8614146.p0 Protein 1e-25 41
PSE_2475 YP_005081005.1 two component response regulator NC_002951.3238224.p0 Protein 1e-25 41
PSE_2475 YP_005081005.1 two component response regulator NC_007793.3914065.p0 Protein 1e-25 41
PSE_2475 YP_005081005.1 two component response regulator NC_002758.1121390.p0 Protein 1e-25 41
PSE_2475 YP_005081005.1 two component response regulator BAC0308 Protein 1e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PSE_2475 YP_005081005.1 two component response regulator VFG0475 Protein 3e-33 46
PSE_2475 YP_005081005.1 two component response regulator VFG1390 Protein 1e-27 41
PSE_2475 YP_005081005.1 two component response regulator VFG0596 Protein 3e-29 41
PSE_2475 YP_005081005.1 two component response regulator VFG0473 Protein 2e-27 41