Gene Information

Name : HPL003_26355 (HPL003_26355)
Accession : YP_005078208.1
Strain : Paenibacillus terrae HPL-003
Genome accession: NC_016641
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5721912 - 5722481 bp
Length : 570 bp
Strand : +
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence :
TTGAGTATTAGTTTAGTTAAAGGACAGAAGATAGACCTAACAAAAAATAATCCGCACTTATCCGTACTAAAAGTAGGTCT
CGGATGGGACCCTATGAAGGGCAGAACAATGGATATTGATGCGTCAGTACTTCTTCTTAATGAGAACGGCAAGCTGACCC
AAAAGAATAACCTAGTGTACTTTGGAAATAAGAATAGCCCTTGTGGGGCCGTCGTACATGGTGGTGACAACTTAACAGGA
CATGGTGACGGTGATGATGAAGTCATTACCGTATCTCTCCAACAACTACCTCCTGAGGTGCACAGAGTGATATTTATTGT
GAATATATTTCGTTTTTTTAGTTTTGGTAGACGTAAGGATTTCAGTATGGTGAACAATGCTTATATTCGGATATTGGATG
CGTCCCAAGCTGAAGAGATTCTCCGATACAACTTGACGGAGGACTATCAAGGAATGTGTAGTATACGTGTAGGTGAGGTT
TACCGTTATGGGAGTGAGTGGAAATTCGGTGCTCTTGGGGAAGGAAGTACCATTACCTCCCTGAAGGATCTTGTCAAAAC
GTATGAATAA

Protein sequence :
MSISLVKGQKIDLTKNNPHLSVLKVGLGWDPMKGRTMDIDASVLLLNENGKLTQKNNLVYFGNKNSPCGAVVHGGDNLTG
HGDGDDEVITVSLQQLPPEVHRVIFIVNIFRFFSFGRRKDFSMVNNAYIRILDASQAEEILRYNLTEDYQGMCSIRVGEV
YRYGSEWKFGALGEGSTITSLKDLVKTYE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-30 42
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-31 42
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-31 42
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 4e-31 42
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-28 42
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-28 42
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-27 42
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-28 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
HPL003_26355 YP_005078208.1 stress protein BAC0390 Protein 3e-32 43
HPL003_26355 YP_005078208.1 stress protein BAC0389 Protein 3e-27 41