Gene Information

Name : HPL003_12615 (HPL003_12615)
Accession : YP_005075501.1
Strain : Paenibacillus terrae HPL-003
Genome accession: NC_016641
Putative virulence/resistance : Resistance
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2719848 - 2720429 bp
Length : 582 bp
Strand : +
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence :
ATGACCATTAGTCTTTCCAAAGGACAACGTATTGATCTGACCAAAACCAATCCCGGCTTGACCCGTGTTGTCGTAGGTCT
TGGATGGGATACGAATAAATACAGCGGTGGCGCGGACTTTGACCTGGATGCTTCGGCTTTCCTGCTTTATGAAGACGGCA
AAGCAAAAGCTGCGGATGATTTTGTATTTTACAACAATCCAACAGGCGGAGCAGGATCTGTTACCCATACGGGCGATAAC
CGCACAGGTGAGGGCGATGGGGATGACGAGCAAATCATCGTTGATTTTTCGAAGATTCCTGCGAACATCCACCGTATCGG
GATCACGGTTACCATTTATGATTACGAGGCACGTGTGCAAAACTTTGGTCAAGTGTCCAATGCTTTCGTACGTGTGGTAG
ACGCAGCGACGGATCGTGAAGTGCTGCGCTACGATTTGGGAGAGGATTTCTCCACCGAAACGGCCGTGGTATTCTGTGAA
TTTTACCGTCAGAATGCGGACTGGAAATTCCAGGCGATCGGCAGTGGCTTTGCTGGTGGATTGGGTGCGCTTGCTAAAAA
CTATGGCTTGGACGCTCAATAA

Protein sequence :
MTISLSKGQRIDLTKTNPGLTRVVVGLGWDTNKYSGGADFDLDASAFLLYEDGKAKAADDFVFYNNPTGGAGSVTHTGDN
RTGEGDGDDEQIIVDFSKIPANIHRIGITVTIYDYEARVQNFGQVSNAFVRVVDAATDREVLRYDLGEDFSTETAVVFCE
FYRQNADWKFQAIGSGFAGGLGALAKNYGLDAQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-47 57
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-44 56
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-44 56
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-44 55
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-40 53
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 7e-41 53
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-40 53
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-40 51
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 1e-26 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
HPL003_12615 YP_005075501.1 hypothetical protein BAC0389 Protein 2e-44 56
HPL003_12615 YP_005075501.1 hypothetical protein BAC0390 Protein 3e-43 53