Gene Information

Name : HPL003_12610 (HPL003_12610)
Accession : YP_005075500.1
Strain : Paenibacillus terrae HPL-003
Genome accession: NC_016641
Putative virulence/resistance : Resistance
Product : general stress protein 16U
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2719233 - 2719808 bp
Length : 576 bp
Strand : +
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence :
ATGGCAATTAACTTATCCAAAGGTCAAAAGATTGATTTGACGAAAACAAATCCAGGCTTGTCCAAAATCACGGTTGGTTT
GGGTTGGGACACGAACAAATACGATGGCGGTAAGGATTTTGACTTGGACGTATCCGTATTTTTGGCTAATGCAGAAGGTA
AAGTAGAATCGGATAAGAACTTCGTCTTTTTCAATAACCCACAAAATGAGAACGGCTCTGTCGTTCATACTGGGGATAAC
CGTACGGGTGATGGTGACGGAGACGACGAGCAAATTAAAATTGATTTGGGCAGCGTGCCTGCTAACGTAGAAAAAATCGC
TTTTACGATTACAATCTATGAAGCTCAAGAACGCAGCCAAAACTTTGGACAAGTGTCCCGTGCTTATGCTCGTATCGTAA
ACGAAGCTAACAATGAAGAATTGGTCCGCTTTGATCTGGGAGAAGATTTCTCAATCGAAACGGGCGTTGTTGTGGGCGAA
TTGTATCGTCATAGCGGTGAGTGGAAGTTTAATGCCATTGGCAGTGGCTACCAGGATGGTCTTGCAGGGTTGACTCGCGA
TTACGGTTTGGCATAA

Protein sequence :
MAINLSKGQKIDLTKTNPGLSKITVGLGWDTNKYDGGKDFDLDVSVFLANAEGKVESDKNFVFFNNPQNENGSVVHTGDN
RTGDGDGDDEQIKIDLGSVPANVEKIAFTITIYEAQERSQNFGQVSRAYARIVNEANNEELVRFDLGEDFSIETGVVVGE
LYRHSGEWKFNAIGSGYQDGLAGLTRDYGLA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-50 58
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-48 55
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-48 55
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-47 54
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 8e-45 53
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-44 53
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-44 53
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-43 49
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 1e-26 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
HPL003_12610 YP_005075500.1 general stress protein 16U BAC0390 Protein 9e-47 55
HPL003_12610 YP_005075500.1 general stress protein 16U BAC0389 Protein 6e-48 55