Gene Information

Name : NIES39_H00910 (NIES39_H00910)
Accession : YP_005069554.1
Strain : Arthrospira platensis NIES-39
Genome accession: NC_016640
Putative virulence/resistance : Virulence
Product : two-component response regulator (OmpR subfamily)
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3214142 - 3214903 bp
Length : 762 bp
Strand : -
Note : -

DNA sequence :
ATGCCCCGAATTTTAGTGATTGATGATGATCCCGCGATCGCAGAGCTGGTGGCGATTAACCTAGAGATGGCTGGTTATGA
AGTCACCCTCGCCCCCGATGGTATAGTAGGACAAGCACTAGCGCTGCAACTACTGCCAGACCTGATTATTTTAGACCTAA
TGTTGCCCAAAGTCGATGGGTTCACCGTCTGTCAGCGTCTACGCCGAGATGAACGCACCGGAGAGATCCCGGTTTTGATG
TTGACAGCTTTGGGACAAACCCAGGATAAAGTGGAAGGCTTTAACGCTGGGGCTGATGATTATTTAACTAAACCCTTTGA
ACTCGAAGAAATGCTGGCTCGTGTCCGCGCGCTATTGCGACGCACCGATCGCATTCCGCAAGCGGCTAAACACAGCGAGA
TCCTCAGTTATGGAGTTCTTACCCTAGTTCCCGAAAGGTTCGAGGCGATCTGGTTTGATCAGACAGTCAAACTAACTCAC
CTAGAATTTGAGTTACTGCACTGTTTGCTACAACGTCACGGTCAAACCGTAGCCCCCAGTGAAATTCTCAAGGAAGTTTG
GGGCTATGACCCGGACGATGATATCGAAACTATCCGGGTTCATATTCGCCATTTACGCACCAAAATGGAACCAGACCCAC
GTCATCCTCGCTACATCAAAACCGTTTATGGTGCTGGTTACTGTTTGGAACTCCCAGGTAACGGCAAAAACTCATCGGAG
GTGGGAGAGACTGATCTATCTGATGTATCTGATCAGGTGTAG

Protein sequence :
MPRILVIDDDPAIAELVAINLEMAGYEVTLAPDGIVGQALALQLLPDLIILDLMLPKVDGFTVCQRLRRDERTGEIPVLM
LTALGQTQDKVEGFNAGADDYLTKPFELEEMLARVRALLRRTDRIPQAAKHSEILSYGVLTLVPERFEAIWFDQTVKLTH
LEFELLHCLLQRHGQTVAPSEILKEVWGYDPDDDIETIRVHIRHLRTKMEPDPRHPRYIKTVYGAGYCLELPGNGKNSSE
VGETDLSDVSDQV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-20 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NIES39_H00910 YP_005069554.1 two-component response regulator (OmpR subfamily) NC_002952.2859905.p0 Protein 3e-34 43
NIES39_H00910 YP_005069554.1 two-component response regulator (OmpR subfamily) NC_013450.8614421.p0 Protein 2e-34 43
NIES39_H00910 YP_005069554.1 two-component response regulator (OmpR subfamily) NC_007793.3914279.p0 Protein 2e-34 43
NIES39_H00910 YP_005069554.1 two-component response regulator (OmpR subfamily) NC_007622.3794472.p0 Protein 2e-34 43
NIES39_H00910 YP_005069554.1 two-component response regulator (OmpR subfamily) NC_002745.1124361.p0 Protein 2e-34 43
NIES39_H00910 YP_005069554.1 two-component response regulator (OmpR subfamily) NC_009782.5559369.p0 Protein 2e-34 43
NIES39_H00910 YP_005069554.1 two-component response regulator (OmpR subfamily) NC_002951.3237708.p0 Protein 2e-34 43
NIES39_H00910 YP_005069554.1 two-component response regulator (OmpR subfamily) NC_002758.1121668.p0 Protein 2e-34 43
NIES39_H00910 YP_005069554.1 two-component response regulator (OmpR subfamily) NC_009641.5332272.p0 Protein 2e-34 43
NIES39_H00910 YP_005069554.1 two-component response regulator (OmpR subfamily) NC_003923.1003749.p0 Protein 2e-34 43
NIES39_H00910 YP_005069554.1 two-component response regulator (OmpR subfamily) HE999704.1.gene2815. Protein 1e-32 43
NIES39_H00910 YP_005069554.1 two-component response regulator (OmpR subfamily) BAC0125 Protein 4e-26 41
NIES39_H00910 YP_005069554.1 two-component response regulator (OmpR subfamily) BAC0308 Protein 1e-22 41
NIES39_H00910 YP_005069554.1 two-component response regulator (OmpR subfamily) NC_012469.1.7685629. Protein 9e-33 41
NIES39_H00910 YP_005069554.1 two-component response regulator (OmpR subfamily) AF155139.2.orf0.gene Protein 6e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NIES39_H00910 YP_005069554.1 two-component response regulator (OmpR subfamily) VFG1390 Protein 7e-33 43
NIES39_H00910 YP_005069554.1 two-component response regulator (OmpR subfamily) VFG0596 Protein 1e-20 41